KEGG   Cyanobacterium aponinum: Cyan10605_2865Help
Entry
Cyan10605_2865    CDS       T02376                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
can  Cyanobacterium aponinum
Pathway
can00260  Glycine, serine and threonine metabolism
can00750  Vitamin B6 metabolism
can01100  Metabolic pathways
can01110  Biosynthesis of secondary metabolites
can01120  Microbial metabolism in diverse environments
can01230  Biosynthesis of amino acids
Module
can_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan10605_2865
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cyan10605_2865
Enzymes [BR:can01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cyan10605_2865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: AFZ54931
UniProt: K9Z6W3
Position
complement(3407218..3408333)
Genome map
AA seq 371 aa AA seqDB search
MPVVATKLDQPSTTYHVKAGWKGLIEEYKHYLPVTESTPIITLREGNTPLIPVSSISKMI
GRNVKVYVKYDGLNPTGSFKDRGMTMAISKAKEAGAQAVICASTGNTSAAAAAYATRAGM
KAFVIIPDGYVALGKLAQALIYGAEVLAIDGNFDDALTIVREMAESYPVTLVNSVNPYRL
EGQKTAAFEVVDTLGYAPDWLAIPVGNAGNITAYWMGFCQYHSENKCDILPKMMGFQAAG
SAPFVEGHQVLKPETIATAIRIGNPANWEKALSVREASQGQFNAVTDEEILEAYRILGRE
EGVFCEPASAASVAGVLKLKEQIPDNGTVVCVLTGNGLKDPDSAMKLSESGIRGGIKADL
NEVARIMGFIS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtggtagcaacgaaactagatcaaccatcaacaacttatcatgttaaagcaggg
tggaaaggcttaatagaagaatataagcactatttgcctgtcacagaatctactcctatt
attactcttagagaaggaaatacacccttgatacctgtgtcatccatctcaaaaatgatt
ggcagaaatgtcaaagtttatgttaaatatgatggcttgaatcccacgggttcattcaaa
gatagaggaatgacaatggctatttccaaagccaaagaagcgggggctcaagctgtgatt
tgtgccagtacaggcaacacatctgccgccgccgccgcctatgccaccagagcaggaatg
aaagcatttgttattattcctgacggttatgttgcccttggtaagttagcacaggcttta
atttatggagcggaagtattagccattgatggtaattttgatgacgctttaacaatcgtc
agagaaatggcggaaagttatcctgttaccctcgtaaattccgtcaatccctaccgtttg
gaaggtcaaaaaacagccgcttttgaggtagttgatacccttggttatgctcctgactgg
ttagctattcctgtgggtaatgcaggaaatattactgcttattggatgggtttttgtcaa
tatcacagtgagaataagtgtgacatattacctaaaatgatgggtttccaagccgcaggt
tcagctccttttgtggaagggcatcaggtattaaaaccagaaaccatcgcaacagccatt
agaattggcaatcccgccaactgggaaaaggctttatctgttagagaggcttctcaagga
caatttaatgcggtcacggatgaggaaatattagaggcatatcgtattttgggcagggaa
gaaggggttttctgtgaacctgctagtgcggcttccgtggctggagtcttaaaactgaaa
gagcaaattcctgataatggtactgttgtttgtgttttaacgggtaatggattaaaagat
cctgatagtgccatgaaattaagtgaaagcggcattagagggggcattaaagctgatttg
aatgaagttgcccgaattatgggatttattagttag

DBGET integrated database retrieval system