KEGG   Cyanobacterium aponinum: Cyan10605_3028Help
Entry
Cyan10605_3028    CDS       T02376                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
can  Cyanobacterium aponinum
Pathway
can00860  Porphyrin and chlorophyll metabolism
can01100  Metabolic pathways
can01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan10605_3028
Enzymes [BR:can01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cyan10605_3028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase VWA_2 VWA MCM AAA_5 Sigma54_activat VWA_3 Mito_fiss_reg PAXIP1_C CAP_N
Motif
Other DBs
NCBI-ProteinID: AFZ55087
UniProt: K9Z8N5
Position
3598383..3600428
Genome map
AA seq 681 aa AA seqDB search
MPTLKTINTNFPLTAVIGQQAIKTALLLAAVDPQLGGVAIAGKRGTAKSVMARGIHALLP
PIEVIKDSRFNCDPDNRQDWDSETLEIYGNTPREEIPTEVIPAPFVQIPLGTTEDRLLGS
VDVEESVKRGEPVFQPGLLAQAHRGVLYIDEINLLDDQIANQLLSVLTDGKNQIEREGIS
FAHPCKPLLIATYNPEEGALREHLLDRVAIALSADGVLALDERVQAVDQVIDYAASPQQF
LQQYDEDMDALKTEIILAREWIKEVKITQDQVKYLVQEAIRGAVEGHRAEIFAVRVAMAS
AALEGRNNVSADDLRKAVELVIVPRSTLIQTPPDEQMQPPPPPPPPQPQDQGEDEGENQD
QDQDDSQEEDKKDNENQEQDETPQIPEEFVFDVEGVILDPSVLYFAQQMQRQGKSGARNL
IFTDDRGRYIKPMLPKGKVRRIAVDATLRAAAPYQKSRRERYPNRRVIVEQSDLRSKRLA
RKAGALIVFVVDASGSMALNRMQSAKGAVMRLLTEAYENRDQVALIPFRGEQADVLLPPT
RSITLARTRLETLPCGGGSPLSHALTQAVHVGVNAQMSGDIGQVVIVAITDGRGNIPLAR
SLGETLEEGEKPDIKAELLDIATKIRAMGMKLLVIDTEKKFVSTGFGKELAKQAGGNYYQ
LPKATDQAIANMAKGAIADLK
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgccaacactaaaaactattaatacaaactttcctttaactgccgttattgggcaacaa
gccattaaaaccgcccttctcctcgccgccgttgatcctcaattggggggagttgcgatc
gcaggtaaacggggtacagcaaaatcagttatggctaggggaatccatgccctattacct
cctattgaagtaatcaaagatagtcgtttcaactgtgatcccgataatcgacaagattgg
gatagtgaaaccctcgaaatttatggcaacacccctagagaggaaatccccacggaagta
atacctgccccttttgtgcaaatacctttaggtacaacggaagataggcttttgggttcg
gtggatgtggaagagtccgttaagcgtggtgaaccagtatttcagcccggattgttagca
caggcacaccgtggggttttatatatcgatgaaattaacttgttagatgaccaaatcgcc
aatcaactgttaagcgtcttaaccgatggtaaaaatcaaattgaacgggaaggcatcagt
tttgcgcatccatgcaaacctttactcatcgctacctataaccccgaagaaggggcattg
cgagaacatttattggatagagttgcgatcgcgcttagtgctgatggagtattggcgtta
gatgaaagagtccaagcggtggatcaagtgatcgattatgcggcttcccctcaacaattc
ttgcaacaatatgatgaggatatggacgcactgaaaaccgagattatccttgcaagggag
tggattaaagaagtaaaaattactcaagatcaggttaagtatttagtgcaagaagccatc
agaggggcagtagaagggcatagagcggagattttcgctgtcagggtagctatggcatcg
gcggcattagaaggacgcaataacgtcagcgcggatgatttgcgtaaagcggtggaattg
gtgattgtacctcgctcaaccctgattcaaacacccccagatgagcaaatgcaacctcct
ccacctcccccaccaccacaaccccaagatcaaggagaagatgaaggggaaaatcaagat
caggatcaagatgattcccaagaagaagataaaaaagataatgaaaatcaagaacaggat
gaaactccgcaaattcccgaggagtttgtttttgatgtggaaggggtgattttagatccc
agtgtcttgtattttgcccaacagatgcaaagacagggtaagtccggtgctcgtaacctc
attttcaccgatgatcgaggacgctatattaagcccatgttaccaaaagggaaagtaaga
cgtatcgctgttgatgccacattgagggcggcggcaccctatcaaaaaagtcgccgtgaa
cgctatcctaatcgccgtgttatcgtggagcagagtgatttgaggtcaaaacgcctcgca
aggaaagcaggggctttaatcgtctttgtggtggatgcgtccggatcgatggctcttaat
cggatgcagtcggcaaagggtgcggtaatgcggttattaacggaagcctacgaaaatcga
gatcaggtggcgttaattcccttccgaggtgaacaggcggacgtattattgcctcctact
cgttccattactttagcccgtacccgtttggaaaccttgccttgcggtggtggttcgcct
ttatcccatgccttaactcaggcggttcatgtgggggtaaatgcccagatgtcgggggat
attggacaggttgtcattgtggcgattacggacggacgggggaatattcctttggcgcga
tctctcggtgaaacccttgaagaaggagaaaaacccgatattaaggcggaattgttggat
attgccacgaaaatccgtgctatgggcatgaaattgctggttatcgacacggagaagaag
tttgtttctactggcttcggtaaggagttggctaaacaagcaggaggtaattattatcag
ttaccaaaggctacagatcaggctattgcgaatatggcaaagggtgcgatcgctgatttg
aagtag

DBGET integrated database retrieval system