KEGG   Cyanobacterium aponinum: Cyan10605_3220Help
Entry
Cyan10605_3220    CDS       T02376                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
can  Cyanobacterium aponinum
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:can00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3814723..3815880)
Genome map
AA seq 385 aa AA seqDB search
MSNLPESEAQKALQKESELSFTGWQQEVQQGLDYGLEAAESIKDRTISTFSRGELPHYAG
INTFLKAPYLEDVKQVGNYDVAIVGVPHDSGTTYRPGTRFGPQGIRKISALYTPYNFELG
VDLREQIKLCDVGDIFTIPANNEKSFDQISKGVAHIFKSGAFPIILGGDHSIGFPTLRGV
CRHLGDKKVGIIHFDRHVDTQETDLDERMHTCPWFHATNMKNAPAKNLVQLGIGGWQVPR
QGVKVCRERATNILTVTDITEMGLDAAADFAIEKATDGTDCVWISFDIDCIDAGFVPGTG
WPEPGGLLPREALYLLKKIVQNTTVCGIEVVEVSPPYDVSDMTALMATRVICDTMAHLVV
SGQLPRKQKPDYIHEEAQVVDQPWS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatctaccagaaagtgaagctcaaaaggcactacaaaaagagtctgaattatct
ttcacgggatggcaacaggaagttcaacagggcttagactatggtttagaagccgccgaa
agtattaaagatcgcaccatttccactttttcccgtggcgaattgccccattatgccggg
attaatacttttctcaaagccccttatttagaagatgttaagcaagtgggtaactatgac
gttgcgatcgttggtgtcccccatgattcaggtactacttatcgccccggtacaagattt
ggtcctcaaggcattcgtaaaataagtgctttatatactccgtataattttgagttggga
gttgatttacgggaacaaattaaactctgtgatgtgggggatatttttaccattcctgct
aataatgaaaaatcctttgatcaaatttccaagggggttgcccatatcttcaaatctggg
gcgtttcctatcattctggggggagatcattctatcggtttccccactttgagaggagtt
tgtcgtcatttgggggataaaaaggtgggaataatacatttcgatcgccatgtggatacc
caagagacagatttagacgaaagaatgcacacttgtccttggtttcatgctactaacatg
aaaaatgcccctgcgaaaaatcttgttcagcttggcataggtggttggcaagtacctcgt
cagggagtcaaagtttgtcgagaaagggcaactaatatcttaactgttaccgacataacg
gaaatgggcttagatgcggcggcggattttgccattgaaaaagcaaccgatggtactgat
tgcgtctggattagctttgatattgactgtattgatgctggatttgtgccgggtacagga
tggcctgaaccgggtggcttattaccccgtgaggctttatatttacttaagaaaatcgtg
caaaatacgactgtttgcggtattgaggtggtagaagtttctcctccctatgatgtcagt
gacatgacggctttaatggcaactcgtgttatttgtgacactatggctcatttagtggta
tcaggacaattaccccgtaaacaaaaacccgactatatccacgaagaagcccaagtagtt
gatcaaccttggagttaa

DBGET integrated database retrieval system