KEGG   Cyanobacterium aponinum: Cyan10605_3354Help
Entry
Cyan10605_3354    CDS       T02376                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
can  Cyanobacterium aponinum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cyan10605_3354
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan10605_3354
   00620 Pyruvate metabolism
    Cyan10605_3354
   00650 Butanoate metabolism
    Cyan10605_3354
  Lipid metabolism
   00071 Fatty acid degradation
    Cyan10605_3354
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cyan10605_3354
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cyan10605_3354
   00626 Naphthalene degradation
    Cyan10605_3354
Enzymes [BR:can01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cyan10605_3354
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cyan10605_3354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3974705..3977344)
Genome map
AA seq 879 aa AA seqDB search
MEFASSLAFLEQLISNVKKAQQKYAHFSQEEVDRIFKRAALAANSARIPLAKMACEETGM
GIVEDKVIKNHFASEIIYNKYRDEKTCGVVEKDECYGIEKIAEPLGVIAGIIPTTNPTST
AIFKTLLALKTRNAIILSPHPRAKKCTIEAAKIVRDAAIAAGAPEDIIGWIEEPTLQASQ
ALMQHPDIKLILATGGPGMVKAAYSSGHPSLGVGAGNTPAVIEKSAHIKMAVSSIMLSKT
FDNGMICASEQSVIVENAIYEEFKQEFELRGAYFLKDKETDQLRNILLKDGRINAEIVGQ
SVQKIAQLANITIPADTKVLIGEVEKIGYDEPFAYEKLSPILAMYRADTFEDATEKAAQL
VELGGKGHTSSIYISPDKHKEIAYFESKMETARVLVNTPSSVGAIGDLYNFRLDPSLTLG
CGSWGGNSISGNVGVQHLLNIKTITERRENMLWFRVPPKVYFKYGSLPVALGDLAGKEKA
FIVTDKPLYELGMTKKIESVLEQMGIKYDIFYDVEPDPCLATVSRGLALLNSFNPDVIIA
LGGGSPMDAAKVMWLMYEQPDIEFEGIATRFMDIRKRVYDLPELGKKAIMVAIPTTSGTG
SEVTPFAVVTDEKTGIKYPLADYALTPNIAIVDPELVLNMPKSLTAFGGIDALTHALEAY
VSIYSTEFTSGLALKAIGLLFKYLPNAYHNGAKDLKAREKVHYAATIAGMAFANSFLGIC
HSLAHKLGSSFHVPHGLANALMISHVIRYNATDAPFKQAIFPQYKYPNAKFRYAQIADYL
QLGGVTDDEKVEKLVEAVENLKKELNIPLTIREVLSIEDQQFYDEIESLAEQAFDDQCTG
TNPRYPLIKDMKELYIMAYRGFNLESQFYHQPEEETVVN
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgctagtagtttagcattcttagagcagttaattagtaatgttaaaaaagct
caacaaaagtatgcacatttttctcaagaagaagtagatcgcatcttcaaaagggcggca
ttggcagcaaactcagcccgaatccccttagctaaaatggcttgtgaagaaactgggatg
ggaattgttgaagataaagtaataaaaaatcactttgcttctgaaattatttataacaaa
tatcgtgacgaaaaaacttgcggagtcgtagaaaaagatgaatgttatggtatagaaaaa
attgctgaacctttaggagtaatcgcaggaattattcccactactaaccccacttctacg
gcaatttttaaaactcttttagccctcaaaactcgcaacgcaattattctctctcctcac
cctagagcgaaaaaatgtaccatcgaagcagcaaaaattgtcagagatgctgcgatcgcg
gctggagcaccggaggatataattggatggatagaagagccgacattacaagcctctcag
gcattgatgcaacacccagatattaagctaatccttgccacaggaggaccggggatggtg
aaagcggcttattcctctggacatccttctttaggggtaggggcaggaaatacccccgct
gttatcgaaaaaagcgcccatatcaaaatggcagtatcttcgattatgctcagtaaaacc
tttgataatggcatgatttgcgcttctgaacagtctgtgatagttgaaaatgctatttat
gaggaatttaaacaggaatttgagcttaggggggcgtacttcctcaaagataaagaaact
gatcaattgagaaatattctactcaaagatggtagaatcaacgcagagatagtggggcag
tccgtgcaaaaaatcgctcaactagctaatattaccattcctgccgacaccaaagtatta
attggagaagtggaaaaaattggttatgatgagccttttgcttatgaaaaattatctccc
attttagcaatgtatcgagcagacacctttgaagatgcaacagaaaaagcggctcaatta
gtagaattgggtggaaaagggcatacatcctcaatttatattagtcctgataagcacaaa
gaaatcgcttattttgaaagtaaaatggaaaccgctagggtattagtaaatactccctcc
tccgtaggtgcgatcggggatttatataacttccgtcttgatccgtctttaaccctcggt
tgtggtagttggggcggtaactccatcagtggtaatgtgggagtgcaacatttactcaac
attaagactatcaccgaacggcgagaaaatatgctttggtttcgtgtaccgccgaaggtt
tacttcaaatacggtagcttacccgttgctttaggggatttagcaggaaaagaaaaggct
ttcatcgtcaccgataaacctctctacgaattgggcatgacaaagaaaatagagagtgtt
ttagagcaaatgggcataaaatatgatattttctacgatgttgagcctgatccttgcctt
gctaccgtcagtcgtggtttagctctgttaaacagctttaatcctgatgttatcatcgcc
ctcgggggaggttcaccgatggatgcggcaaaagtgatgtggttaatgtacgaacaaccc
gatatcgaatttgaaggcatcgccactcggtttatggatattcgcaaacgggtatatgac
ttaccagagttgggcaaaaaagcgattatggtagccattcccactacatcaggcacaggc
tcagaagtaacaccttttgcagtcgtcaccgatgaaaaaacgggcattaaatatcccctt
gctgactatgctttaacccctaatattgccatagttgatcctgaattggtgttaaatatg
cccaaaagtttgacggcatttggaggcattgacgctttaacccacgctttagaggcttat
gtgtctatctactccaccgagtttaccagtggtttagcattaaaggcgatcggactttta
tttaaatacttacccaatgcttatcataacggggcaaaagatctcaaagcaagggaaaaa
gtacactacgccgctaccattgccggaatggcttttgctaactccttcttaggtatctgt
cactcattggctcacaaactaggttcaagtttccatgtacctcacggattggctaatgcg
ttgatgatttcccacgttattcgttacaatgccacggatgcaccctttaaacaggcgatt
ttccctcaatataagtatcctaacgctaaatttcgctatgctcaaattgccgactattta
cagttagggggcgtcaccgatgatgagaaggtagagaaactcgtcgaagcggtggaaaac
ctgaaaaaagagttaaatatacctcttaccatccgagaagtcttatccattgaagatcaa
caattttatgatgagatagaaagtttagcagaacaagccttcgatgatcaatgcactggt
acaaatccccgctatcctttaattaaagatatgaaggaattgtatatcatggcttatcgt
ggctttaatcttgaatcccaattctatcaccaaccagaggaagagacagtggttaactag

DBGET integrated database retrieval system