KEGG   Cyanobacterium aponinum: Cyan10605_3364Help
Entry
Cyan10605_3364    CDS       T02376                                 

Definition
acireductone dioxygenase apoprotein (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
can  Cyanobacterium aponinum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:can00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3982167..3982730
Genome map
AA seq 187 aa AA seqDB search
MTALKIFLDNQPSTPIFDSDSIPEVDRVSKITHKLEEVGVRFQQWQTIENLTSGVSQEEV
LNAYQQEVKQLMDEEGYLTVDVVSLTSAHPQKAEFRQKFLDEHTHSEDEVRFFVDGKGLF
SLHIDNQVFEVLCTRGDLISVPANTRHWFDMGENPHFTAIRFFNNPEGWVANFTGSDIAQ
HFSRLDS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgacagcattaaaaatctttttagataatcaaccctctacacctatttttgatagtgat
agtattcctgaagtggatagagttagtaaaattactcataaactagaagaagtgggagtg
cgctttcaacagtggcaaaccatcgaaaatttaacttctggggtgtctcaagaggaagta
ttaaacgcctatcaacaggaagtaaaacagttaatggatgaggaaggttatttaactgtt
gatgtagttagtttaacctcagctcatccccaaaaggcggaatttagacaaaaattttta
gatgaacacactcatagtgaagatgaagtaagattttttgtggatggtaaaggattgttt
agtcttcatattgataaccaagtgtttgaagtactatgtactaggggagatttaatcagt
gtacctgcgaatactcgtcattggtttgatatgggggaaaatccccattttactgccatc
cgcttttttaataatcctgaaggttgggtagcaaattttactggtagcgacattgcccaa
catttttctcgtttagactcttaa

DBGET integrated database retrieval system