KEGG   Cyanobacterium aponinum: Cyan10605_3401Help
Entry
Cyan10605_3401    CDS       T02376                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
can  Cyanobacterium aponinum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan10605_3401
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan10605_3401
   00020 Citrate cycle (TCA cycle)
    Cyan10605_3401
   00620 Pyruvate metabolism
    Cyan10605_3401
Enzymes [BR:can01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cyan10605_3401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4018705..4020030
Genome map
AA seq 441 aa AA seqDB search
MIYDIFMPALSSTMTEGKIVSWEKQPGDKVEKGETVVVVESDKADMDVESFYSGYLATIL
VPAGSQAPVGDAIAYIAETEAEIEEAKKKASQAQGGNNVTSTPATTPEFKKEVETSPQPV
ATTANTEISPSNTSENNGRIIASPRAKKLAKEFKVDLATIKGSGVNGRITAEDVEKAVGK
APSVTTSTPSLPTITSSIPPQITPTPALGNAAPINNLAGETVPFNTLQQAVVRNMVASLH
VPTFQVSYDITTDALDGLYRKIKTKGVTMTALLAKAVAVTLQKHPIMSATYTEGGIKYND
SINIAVAVAMPDGGLITPVIKNAAQIDIYSLARSWKDLVDRARAKQLQPDEYSTGTFTLS
NLGMFGVSSFTAILPPGQGSILAIGGTRPAVVASKDGLFGVKNQMTVTITCDHRIIYGAD
AASFLKDLANLIENDPHSLTL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgatatatttatgccagccctcagttccacgatgacagaagggaaaatagtt
tcatgggaaaaacaacccggtgataaagttgagaaaggagaaactgttgttgtcgttgaa
tccgacaaggctgatatggatgtagaatctttctactctggttatttagctactattctt
gtccctgccggttctcaagctcctgtgggagatgcgatcgcatatattgctgaaaccgaa
gcagaaatagaagaagccaagaaaaaagccagtcaagcacaagggggaaataatgtcact
tcaacccccgcaactactcctgaattcaaaaaagaagtagaaacctctcctcaacctgtg
gcaaccactgctaacacagaaatctctccctcaaatacttctgaaaataacggtagaatt
atcgcttcccccagagcaaaaaaattagccaaagaatttaaagttgatttagccactatt
aagggtagcggtgtcaacggtagaattaccgccgaagatgtagaaaaagcggtcggaaaa
gcacctagcgtaaccacatctactccttcattgcccaccattacatcctctatacctcct
caaattacccccactcctgccctcggtaatgccgctcccattaataatttagcaggagaa
accgtaccttttaacaccttacaacaagcagttgttcgtaatatggtggctagtttacac
gttcccactttccaagttagctatgatattaccactgatgctttagatggcttatatcgt
aaaatcaaaactaagggagttacaatgactgcattattagccaaagctgttgcagttacc
ctacaaaaacaccccatcatgagtgctacttatacagaaggtggcattaaatataacgat
tctatcaacatcgctgttgccgttgcgatgcccgatggcggtttaattacccctgtgatt
aaaaatgcggctcaaatagatatttattcccttgcccgtagctggaaagatttagtagat
cgtgccagagcaaaacaactacagcctgatgagtacagtacaggtacatttactctttct
aatttagggatgtttggtgtaagtagctttaccgctattttacctcccggacaaggttcg
atcttagccattggtggtactcgccccgccgtagtagctagtaaagacggtttatttggg
gttaaaaatcaaatgacagtgactatcacctgtgatcaccgtatcatctatggtgcagat
gcggcatcattcctcaaagatttagctaatttaattgaaaatgatccccattctttgaca
ttgtag

DBGET integrated database retrieval system