KEGG   Cellulophaga algicola: Celal_0031Help
Entry
Celal_0031        CDS       T01404                                 

Definition
(GenBank) SSU ribosomal protein S18P
  KO
K02963  small subunit ribosomal protein S18
Organism
cao  Cellulophaga algicola
Pathway
cao03010  Ribosome
Module
cao_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cao00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Celal_0031
Ribosome [BR:cao03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Celal_0031
  Bacteria
    Celal_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S18
Motif
Other DBs
NCBI-ProteinID: ADV47389
JGI: Celal_0031
UniProt: E6X689
Position
complement(35762..36058)
Genome map
AA seq 98 aa AA seqDB search
MSSIEQQAKGKKDGEIRYLTPLNIDTNTQKKYCRFKKSGIKYVDYKDPDFLIKLVNEQGK
LLPRRLTGTSLKYQRKVAVAVKRARHLALMPYVGDLLK
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaatagaacaacaagcaaaaggtaaaaaagacggagaaattaggtatttaact
cctctaaatatcgacaccaatactcaaaagaagtattgtcgttttaagaaatctggtatc
aagtatgtagattacaaagatccagactttttaattaaattagttaatgagcaaggtaag
ttacttcctagaagacttactggaacttcattgaagtaccaaagaaaagtggctgtagct
gtgaaaagagcacgtcatttagcattaatgccatatgttggtgatttattaaaataa

DBGET integrated database retrieval system