KEGG   Cellulophaga algicola: Celal_0038Help
Entry
Celal_0038        CDS       T01404                                 

Definition
(GenBank) Ribosomal RNA large subunit methyltransferase H
  KO
K00783  
23S rRNA (pseudouridine1915-N3)-methyltransferase [EC:2.1.1.177]
Organism
cao  Cellulophaga algicola
Brite
Enzymes [BR:cao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.177  23S rRNA (pseudouridine1915-N3)-methyltransferase
     Celal_0038
Ribosome biogenesis [BR:cao03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Celal_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
42181..42654
Genome map
AA seq 157 aa AA seqDB search
MTIKLLAIGKTDSSHLSQLIEEYENRLKHYIKFDLELIPDIKNTKNLSEAQQKEKEGEAI
LKKITNTDVLILLDENGKQFTSIDFSNYLQKKMNSGIKQLVFVIGGPYGFSDAIYNKAQG
KISLSKMTFSHQMIRLFIVEQVYRAFTILKNEPYHHQ
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcaaacttttagccataggaaaaacagacagttctcacctgtctcaacttatt
gaagaatacgaaaatagacttaaacattatatcaaatttgatttagaattaatccccgat
attaaaaacactaaaaatttatcggaagcacaacagaaagaaaaagaaggtgaagccatt
ttaaaaaaaataactaataccgatgttttaattctattagatgaaaatggaaaacaattt
acttctattgatttttctaattatttacaaaaaaaaatgaattcaggaattaaacaattg
gtttttgttattggcggtccttacggttttagcgatgccatttacaacaaagcacaaggc
aaaataagtttatctaaaatgaccttttcccaccaaatgattcgcctttttatagtagaa
caagtataccgagcatttactattttaaaaaacgaaccttaccaccatcaataa

DBGET integrated database retrieval system