KEGG   Cellulophaga algicola: Celal_0040Help
Entry
Celal_0040        CDS       T01404                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
  KO
K00058  
D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
cao  Cellulophaga algicola
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Celal_0040
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celal_0040
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Celal_0040
    1.1.1.399  2-oxoglutarate reductase
     Celal_0040
Exosome [BR:cao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Celal_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(43680..45572)
Genome map
AA seq 630 aa AA seqDB search
MVATGRKYVFDFDSTLTRVEALDVLAELTLNGKSNKEEIIKEIQEITNLGIDGDISFTES
LERRIKLLNAHKDDLPILVEELKTKISKSIEANKDFFRDYADDIYVISCGFKEFIDPIVK
EYNIPSHRVYANTFKFDEEGKIVGFDETNVLAMHNGKIDCLKNMNLDGEVQVIGDGYSDY
VMREAGIAHKFFAYTENVHREKAAKNADYITPNLDEFLFVNDLPRKISYPKNRIKMLLLE
NVHPDAFKSLSEAGFSVETVNHSLTEEELIEKIKGVHVLGIRSKTQVTKNVLEAANKLMV
VGAFCIGTTQIDLDACKAKGVVVFNAPYSNTRSVVELAIGEIIMLMRSVFTRSTEIHQGQ
WNKTAANSREVRGKNLGIVGYGNIGKQLSVLAEALGMRVYYYDVNDQLALGNAVKCNTLE
DLLNISDVVTLHIDDNKANLNFIGEREINQMKNGAIFINLARGFVVDIPALANALKSGKL
AGAAIDVFPEEPRSNGEFETELKGLENVILTPHVGGSTEEAQANIADFVPNKIMDYMNTG
NTVDAVNFPNIRLPKQNKAHRFLHIHKNVPGVMAKVNEVLARYELNITGQYLSTDNEVGY
VISDVNKEYNKDVIKELKKIENTIKFRVLY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaacaggaagaaagtatgtatttgattttgatagtactttaacgcgagttgaa
gcgctagatgttctagcggagcttacactcaatggcaagtccaacaaagaagaaattatt
aaagaaattcaggaaattaccaacttgggaatagacggtgatatttcatttacggaatca
ttagagcgtagaataaaacttttgaatgcgcataaagatgatttgcctattttagttgaa
gagttgaagactaaaatctcaaaatctatagaagcgaataaagatttttttagagattac
gcagatgatatttacgtaatatcttgtggttttaaagaatttatagatcctatagtaaaa
gaatataatattccttcgcatagagtatatgcaaatacgtttaaatttgatgaagaaggc
aaaatagtaggttttgatgaaactaatgttttggcaatgcataatggtaaaatagattgc
ctaaaaaacatgaatcttgacggtgaggttcaggtaattggtgatggctatagcgattat
gtaatgagagaagcaggtattgcgcataagttttttgcctataccgaaaatgtacaccgt
gaaaaagctgcaaaaaatgcagattatattacacctaaccttgatgaatttttatttgtg
aacgatttacctagaaaaatttcctatccaaaaaataggataaaaatgttgttgttagaa
aatgtgcatccagatgcgtttaagagtctatctgaagcaggtttctctgtagaaaccgtt
aaccacagtttaacagaagaagaattaatagaaaaaataaaaggcgtacatgtacttggt
atacgttctaaaacgcaagttactaagaacgtactagaggctgctaataagcttatggtc
gttggtgctttttgtatcggaactacgcaaatagacttagatgcttgtaaggctaaagga
gttgtcgtatttaatgctccttatagtaatacgcgttctgtagtagaattggcaattggg
gaaattattatgctaatgcgtagtgtgtttacgcgtagtaccgaaattcaccaaggacaa
tggaataaaactgctgcaaattctagagaagtacgtggtaaaaacttagggattgttggg
tatgggaacataggtaagcaattatctgttttagcagaagctttaggaatgcgtgtatat
tattatgatgtaaatgatcaattggctttgggtaatgctgtgaaatgtaatacgcttgaa
gatttattgaatatttcagacgtggtaaccctacatatagatgataataaagcaaacctt
aattttataggagaaagagaaattaaccaaatgaaaaatggagctatttttataaattta
gctcgtggttttgtggtagatattccggcattagccaatgcattaaagagtggtaaattg
gcaggtgctgcaatagatgtttttccagaagagcctagaagtaatggtgagtttgaaacg
gagcttaaaggtttagagaatgttattttaacgccacacgttggaggtagtacagaagaa
gcacaagctaatattgcagattttgtaccgaataaaattatggattatatgaatacgggt
aatacggttgatgctgtaaacttccctaatattcgtttaccaaagcaaaacaaagcgcat
aggttcttgcatattcataaaaatgtaccaggagttatggctaaagtaaatgaagtttta
gcacgttatgaactaaatattacaggccagtacttatctacggataatgaagtgggttat
gttatatcagatgtgaataaagaatataataaagatgttataaaggagctaaagaaaata
gaaaacacaattaaatttagagttctttactaa

DBGET integrated database retrieval system