KEGG   Cellulophaga algicola: Celal_0041Help
Entry
Celal_0041        CDS       T01404                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(45744..46529)
Genome map
AA seq 261 aa AA seqDB search
MRTALILIFLQISFAGYAQVEFFTSFDGVKIAYTDEGKGNAVILVHGFITSGSSWDYTVL
KKGLLQKGYRVIIPDLRGSGLSDKPNEAKFYQNNAEIKDLQGLASYLNIKKFDVVGYSRG
SIVTAKWLTCDKRIKKAVLGGMGLDFTNREWGRRILFANAFAEGAVLTEEVKGAVAYAKS
IHANFKALHYLQVYQPVTTVAELKEIKTKVLIIAGDKDLENGNPSELHEVIPRSKFAIIK
GVHNEAYKTASFSKEIISFFK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagaactgctcttattttaatttttttacaaatttcatttgcaggatacgcgcaggta
gaattttttacctcttttgatggggtaaaaattgcctacacagatgaaggaaaaggaaac
gcagttattttagtacatggattcataacttctggaagttcttgggattatactgttttg
aaaaaagggcttttgcaaaaaggctacagggttattattccagatttaagaggtagcggt
ttatcagataaaccgaatgaagcaaaattttatcaaaataatgcagaaataaaagactta
caaggtttggcgtcttatttgaacattaaaaaatttgatgttgtagggtattctagaggt
agtattgttacagcaaagtggctaacctgtgataaacgcattaaaaaagcggtattaggt
ggtatggggctagattttacgaatcgtgaatggggtagacgtattttgtttgcgaatgca
tttgcagaaggcgctgtgttaacagaggaggtgaaaggggctgtggcttatgcaaaatca
atacatgcaaattttaaggccttacattatttgcaagtatatcaaccagtaacaactgtg
gctgaattaaaggaaattaaaacaaaagtgttgattattgcaggagataaggatttagaa
aatggtaatccaagtgaattacatgaggtaattcctaggagtaaatttgcaataattaag
ggagttcataatgaagcgtacaaaacagcatccttttcaaaagaaataatttcatttttc
aagtga

DBGET integrated database retrieval system