KEGG   Cellulophaga algicola: Celal_0050Help
Entry
Celal_0050        CDS       T01404                                 

Definition
(GenBank) tRNA/rRNA methyltransferase (SpoU)
  KO
K00556  
tRNA (guanosine-2'-O-)-methyltransferase [EC:2.1.1.34]
Organism
cao  Cellulophaga algicola
Brite
Enzymes [BR:cao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.34  tRNA (guanosine18-2'-O)-methyltransferase
     Celal_0050
Transfer RNA biogenesis [BR:cao03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    Celal_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(54759..55466)
Genome map
AA seq 235 aa AA seqDB search
MDANLFIKIYILYFYYLRFMIDLKLLNYLEEFISEERKQRFIQVLAERTNKITVAVEDVF
QMHNTSAVVRSCDIFGIQEAHLIERKYGDQLDSQIAMGSQKWVDIHRYESTKNCMDTLKQ
NGYKIIATTPHNDSCLLEDFEIEGKIALFFGTERNGLSEEVLKNADGFLKIPMVGFTESL
NISVSAAIILQSLTTKLKKESTDWQLTDHEKLIKKIDWSKKSIKSIEGVLSRYVS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggacgctaatttatttataaaaatatacattttatatttttattatcttcgatttatg
attgatttaaaacttttaaattatttagaagaatttatctctgaagaacgtaagcaacgt
tttattcaggtattagcagagcgtactaataaaattacggttgcagtagaagatgtgttt
caaatgcataataccagtgcggtggtccggagctgtgatattttcgggattcaagaagca
catttaatagagcgtaagtatggcgaccaattggatagccaaatagcaatgggttctcaa
aaatgggtagatattcataggtatgagagtactaaaaattgtatggataccttaaaacaa
aatggatataaaattatagcaacaactccacataacgattcttgtttgttagaagatttt
gaaattgaaggtaaaattgctcttttttttggaacagagcgaaatgggttaagtgaggaa
gtcttgaaaaatgcagacggatttttaaaaatacccatggttgggtttacagaaagttta
aatatctctgtatcggcagcaattattttacaaagtctaactacaaaattgaagaaagag
agcactgattggcaactcaccgatcatgagaaacttataaaaaaaattgattggtcaaaa
aagtctattaagagcatagaaggtgtattatcacgatatgtaagttag

DBGET integrated database retrieval system