KEGG   Cellulophaga algicola: Celal_0067Help
Entry
Celal_0067        CDS       T01404                                 

Definition
(GenBank) Iron-chelate-transporting ATPase
  KO
K02013  iron complex transport system ATP-binding protein [EC:3.6.3.34]
Organism
cao  Cellulophaga algicola
Pathway
cao02010  ABC transporters
Module
cao_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:cao00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Celal_0067
Enzymes [BR:cao01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.34  iron-chelate-transporting ATPase
     Celal_0067
Transporters [BR:cao02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    Celal_0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N NB-ARC AAA_15 RsgA_GTPase AAA_22 AAA_14 AAA_29 AAA_16 AAA_18 AAA_23 MMR_HSR1 AAA_27
Motif
Other DBs
NCBI-ProteinID: ADV47425
JGI: Celal_0067
UniProt: E6X6C5
Position
70297..71088
Genome map
AA seq 263 aa AA seqDB search
MQTHKKHIALEIANLSIGYQSKKQETLVAQDISFSLNQGELGAIVGINGVGKSTLLRTIG
SVQKSLSGEIHIDNLVLSDYSSLDLATKISLVLTEPIASKNLTVLELIALGRQPYTNWLG
TLTETDKAKTKEAILLVEIEALQHKKCYELSDGQLQRVMIARALAQDTQIILLDEPTSHL
DLYHKVQILKLLKSIAHQTQKTILFTTHEIEVALQLCDKMLLLRKEESYFDTPEALIQGK
HFEKLFPSNMIQFDATTGSFKIV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
attcaaacgcataaaaaacatatcgccctagaaatagcaaatcttagtataggctaccaa
agcaaaaagcaagaaacgcttgttgctcaagatatctccttttccttaaaccaaggagaa
ttaggagctattgttggtatcaatggcgtaggaaaatctaccttattgcgcaccattggt
tcggtacaaaaatcactctcaggagaaattcatatcgataatttagtactctctgactat
tcctctttagatttagctactaagattagccttgtattaacagaacccatcgcctcaaaa
aatttaacggttttagaactcatcgctttaggcaggcaaccatataccaattggctaggc
accctaaccgaaacggataaagctaaaacaaaagaagcaattctattagtagaaatagaa
gcattacaacacaaaaagtgttatgaattaagtgatggccaattacaacgggtcatgatt
gcccgtgcattagcacaagacactcaaataattctattagacgaacctacttctcattta
gatttgtaccacaaagtgcaaatactaaagctccttaaaagtatagcacaccaaacgcaa
aagaccatactgtttactacgcatgaaattgaagttgcgttgcaactatgcgataaaatg
cttttactccgtaaagaagaaagttattttgacacgccagaggctttaattcaaggaaag
cattttgaaaagttattcccttcaaacatgattcagtttgatgctactacgggaagcttt
aaaatagtataa

DBGET integrated database retrieval system