KEGG   Cellulophaga algicola: Celal_0069Help
Entry
Celal_0069        CDS       T01404                                 

Definition
(GenBank) RmuC-domain protein
  KO
K09760  DNA recombination protein RmuC
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RmuC TPD ZYG-11_interact
Motif
Other DBs
NCBI-ProteinID: ADV47427
JGI: Celal_0069
UniProt: E6X6C7
Position
72033..73433
Genome map
AA seq 466 aa AA seqDB search
MNEYIIYLLIGSVGIAIGFFLGNYIQKLKTTSSQSALVAREEQLHISITSLEEKLMKAEE
TTAEIRALSDLDKNELRNEKEVLGNQITRYQADLENLQRKHTEQKEEVEKLQEKFTKEFE
NLANKILDEKSSKFTEQNRENIKNILNPLQEKILLFEKKVDDSQKESVGMHSALKEQLAT
LQLQNLKITQEAENLTKALKGDSKMQGNWGELVLERVLEKSGLEKDREYSVQQSFTREDG
SRVLPDVIINLPDGKKMIVDSKVSLTDYERYVNAEDGLKEKFLKDHINSLRRHVDQLSAK
KYEDLYAMESPDFVLLFVPIEPAFAVAINNDNTLYNKAFEQNIIIVTPSTLLATLRTIDS
MWNNEKQQRNALEIARQAGALYDKFEGFVSDLMKVGKKMDEAKVEYRGAMNKLVDGRGNI
VTSIQKLKKMGAKAKKSIPDSLLKRAHDDINEEEENGSIEESKVNL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtacatcatctatttacttattggtagtgtaggtatcgctataggattcttt
ttaggaaactatattcaaaagcttaagactacctcttcacaaagtgctttggtagcacgt
gaagaacagttgcatatcagcattacttctttagaagaaaaactgatgaaagcagaagaa
actactgctgaaatacgtgctttatccgatttggataaaaatgaacttcgcaatgaaaaa
gaagtgttgggaaatcaaattacccgataccaagcagacttagaaaaccttcaacgtaaa
catacagaacaaaaagaagaagtagaaaaacttcaagaaaaatttaccaaagaatttgaa
aatcttgcgaataaaattctagatgaaaaaagcagcaagtttacggaacaaaacagagag
aatatcaaaaatattctgaatccactacaagaaaaaatactcctgtttgaaaaaaaggta
gatgatagccaaaaagaaagtgtaggcatgcattctgcacttaaagagcaattagcaacg
ctacaattacaaaatttaaaaattacccaagaggcagaaaaccttacgaaagctttaaaa
ggcgatagtaaaatgcaaggaaattggggggaactggttttagaacgtgtgcttgaaaaa
tctggcctcgaaaaagatagggagtattctgtacagcaaagttttacccgagaagatggt
tccagagttttaccagatgtaattattaacctaccggatggtaaaaagatgattgtagat
tctaaggtatccttgactgattatgaacgttatgtaaatgctgaagatggtttaaaagag
aagttcttaaaagaccatatcaattctcttcgccgtcatgtagaccaattatctgctaaa
aaatatgaagatctatatgcaatggaaagtccagattttgttttgctttttgttcctata
gaacctgcttttgctgtcgccattaacaatgacaacacgttatacaacaaagcttttgag
cagaatattatcatcgtaacaccttctacccttttggctacattacgtactattgatagc
atgtggaataatgaaaaacaacaacgtaacgccttagagattgcaagacaagcgggtgcg
ctttatgataagtttgaaggttttgtgagcgatttaatgaaggttggtaaaaaaatggac
gaagctaaagtagaatatcgtggtgctatgaataaattggttgatggccgcggtaatatt
gtaactagtattcagaaactaaagaaaatgggcgctaaagccaaaaagtctattcctgat
tctttattaaaaagagcgcatgatgatattaatgaggaagaagaaaacggaagtattgag
gaatctaaggtcaatttgtaa

DBGET integrated database retrieval system