KEGG   Cellulophaga algicola: Celal_0076Help
Entry
Celal_0076        CDS       T01404                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  
6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
cao  Cellulophaga algicola
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Celal_0076
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Celal_0076
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     Celal_0076
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     Celal_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
79319..80731
Genome map
AA seq 470 aa AA seqDB search
MKHTDYDFGLVGLGVMGRNFILNVADNNFKAFGYDLDQEKVDALKTEGGNLERVNAATDI
KTFVNALATPRKIMLLVPAGKIVDAVIENLLPFLAKDDIIIDGGNSFFTDTDRREAYLQE
KGIHFFGSGVSGGAKGARKGPSIMPGGNKEAYAHVKPIFEAVSAKYNGEPCVAYLGPKSA
GNYVKMVHNGIEYGLMQLTSEIYDILRKAGGLTNDELHTVFDTWNKGRLQSFLVEITAEI
FNQKDDKSDGRLVDKILDKAKQKGTGKWTSQNAMDLGIPVPSIDIAVSMREISSLKEERV
EADGLYGRPEVAPIAKEDLIAMAEEALYFAFITTYAQGLHQLADASKEYKYELDLSVIAK
IWRAGCIIRAGLLADISSAYVENKDLKNLLLAPSFVPKVQKAVPSSRKLVAYAATSGIPM
PGLSNSLTYFDAYTSSKLPLNLIQAQRDHFGSHTYERTDVEGIFHTEWGA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatacagattatgattttggattagtaggacttggcgttatggggcgtaatttt
atcttaaatgtcgcagataataattttaaggcctttggttatgacttagatcaagaaaag
gttgatgccttgaaaaccgaaggtggaaatttagagcgcgttaatgccgctactgatatt
aaaacttttgtaaatgccttagctactccgcgaaaaataatgctattagtacctgcaggt
aaaattgttgatgctgtaatagaaaacttattgccttttttagcaaaagatgacattatt
attgatggtggaaattctttctttacagatacagaccgtagagaagcttacttacaagaa
aaaggaattcacttttttggttctggagtttctggtggcgcaaaaggagcacgcaaaggc
cctagtattatgcctggaggtaataaagaagcgtatgcacatgttaaacctattttcgaa
gcagtttctgctaaatataacggagaaccttgtgtagcctatttaggccctaaatctgcc
ggaaattatgtaaaaatggtacataatggtattgagtacggtttaatgcaactaacttct
gaaatttatgatattcttagaaaagctggcgggctcacaaatgatgaattacacactgtc
tttgacacttggaataaaggaaggttacaatcttttttagttgaaataacagctgaaatt
tttaaccagaaagatgataaaagtgatggtcgtttagtggataaaattttagacaaagca
aaacaaaaaggtactggaaaatggacctcacaaaatgccatggatttaggtattcctgtt
ccttctattgatattgcagttagcatgcgcgaaatttcttccttaaaagaagagcgcgta
gaagcagatggattgtatggcagacctgaagttgccccaatagcaaaagaagatttaatt
gccatggccgaagaagctttgtattttgcttttataacaacctacgctcaaggcttacat
caattagcagatgcatcaaaagaatacaagtatgagttagatttatctgtgattgctaaa
atctggagagctggctgtattatcagagctggtttacttgctgatatttctagtgcttat
gtagaaaacaaagacttaaagaatttactattagcaccttcttttgttcctaaagtacag
aaagcagttccttcctctagaaaattagttgcttatgctgctactagcggaattccaatg
ccagggctatcaaattcattaacttattttgatgcctatacttctagtaaattaccttta
aatttaatccaagcacaaagagatcactttgggtcgcatacctatgaacgtacagatgta
gaaggtattttccatacagaatggggtgcttaa

DBGET integrated database retrieval system