KEGG   Cellulophaga algicola: Celal_0078Help
Entry
Celal_0078        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4345
Motif
Other DBs
NCBI-ProteinID: ADV47436
JGI: Celal_0078
UniProt: E6X6D6
Position
81293..81742
Genome map
AA seq 149 aa AA seqDB search
MDFLFDTFLFVTKKDMLFYKNPKYKNLQLTLSAFVVISVSFVYGGNPSVFLPYVFGFDVI
DIDLKNILRAIMGLYLAIGGFWVYGICNKNYWESATLINILFMGGLAFGRLVSTLLDGIS
PQFMVGLILEFMFMLWGIYNLKVYRKNNL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggattttttatttgatacctttctttttgtaacaaaaaaagatatgcttttttacaaa
aaccctaagtacaagaatctacaattaacactttccgcatttgtagtgataagtgtaagc
tttgtatatggaggaaacccaagtgtttttcttccttatgtttttggttttgatgtaatt
gatattgatttaaaaaatatactcagagctataatggggttataccttgctatcggtggc
ttttgggtttacggaatatgcaataagaattattgggaatctgcaacgctcatcaatatt
ttattcatgggtggcttagcctttggaagacttgtaagcaccctacttgatggaatatct
ccccaatttatggtaggtcttattttagaatttatgtttatgctttggggaatttataac
ctgaaagtatatcgtaaaaataatctataa

DBGET integrated database retrieval system