KEGG   Cellulophaga algicola: Celal_0085Help
Entry
Celal_0085        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
  KO
K06975  
uncharacterized protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
89217..89513
Genome map
AA seq 98 aa AA seqDB search
MNEVNITDNSFLRQFETTVNGHLAKIEYSAQERKIFLTKLIIPETITQEDFKEQFIEAVL
NVIQERNLRVVPTSPEIAGFLRKNSRKYKDMLPVGIRI
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtaaacattacagacaatagtttcttacgccaatttgaaacaacggttaat
gggcacttagcaaagattgaatattctgctcaggaaagaaagatttttttaactaaatta
attattcctgaaacaattacccaagaagactttaaagaacaattcattgaagccgtgtta
aacgtaattcaagaaagaaatttacgcgtagtacctacaagtccagaaatagctggattt
cttagaaaaaatagcagaaaatacaaagatatgctccctgtaggcattcgaatctaa

DBGET integrated database retrieval system