KEGG   Cellulophaga algicola: Celal_0101Help
Entry
Celal_0101        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(107066..109666)
Genome map
AA seq 866 aa AA seqDB search
MKKRYFNHYYALFVMFFVLSFSGLKAQSEPFQCDFNAYLFQYNDIYAVDLASGGSYIVAE
NVTPGSINAAAYNSADGYIWGYLSSPAKSIVRIGKDFKPEIFEIPELPDTKNKFVGDISI
DGIYYFKAGGSTFYGIDLNPTSDTYLEYLGSFTLTKNISIHDWAFNAVDNKLYAVEKGSN
TLYRISVGTGDVEELGVVPILSGFNYTYGAVYFDVDGNFYVSANQTGSVYKINNVQTISN
GAMVSNIFAFGPASASNDGARCPTAPLPQEDCINGVDDDGDGLVDCDDPSCSGISSCPTI
TTTSGGNDGGLESNDRLSTLINQRNFNRANTNYKFDKSSAKTIKKGFNYKRKDAFTSKDI
PLNTLVPLGIVGETSTIESSPADLLALTNASDIFSVDYLKESETVSALMVIKTDDNVYEH
SKFICDRFLGAQLLSVSTIQLREKDFIKSIIKQADGSIEFALTFSARVNENDEFVVESHW
NIDAYEKNTAYYNFQIWSNSVDDLLKLGDEILNLLEANSAIVDYRGSTPPPVFVRSASYA
NGTINLQLTNNNKSTSITMDGGMKKTETSGTDNLNLATSIATRVESITVETGALFDFGFR
IQNAQGDTPDDLFVADAPWGLDESSDNTTVDIYEVLQNKASYAYSGYRIERNVHAKGTTA
NYLGVYRALTPRFQAVDLSAYEKLSFNASGTGALEVKLLKGDGSFYTTELVLTEEDKMFE
ILASDFKDETNSVADFANLKVVLFNMHSTDGSVQEKEMTISEIDFNNRSEIEEEIIVEEE
TSTKALIYPNPVKASTTLYYTSRTDDTYTLELFSLNGILLSNHSQEGTHAVGQNEITIPR
KDLSPGIYFYKLASRDQIWSGKIVVK
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgttacttcaaccactattatgcattgtttgttatgttttttgttctctca
tttagtggtctaaaagcacaatcagaaccatttcaatgtgattttaatgcttatttattt
cagtacaatgatatttatgctgttgatttagcttctggcggatcttacatagtagcggaa
aatgtaactcctggaagtatcaatgcagcggcgtataattctgcagatggttacatatgg
ggttatttatcgtctcctgctaaatcaattgttcgtataggtaaagattttaaaccagaa
atttttgagattccagaattacctgatactaaaaataaatttgtaggagatattagtatt
gatgggatttattatttcaaagcaggaggtagtactttttatggaatagatttaaatcca
acttctgatacttacttagaatatcttggttcttttaccttaactaagaatattagtata
catgattgggccttcaatgcggtggataacaaattatatgcggttgaaaaagggtccaat
acgttgtatagaatttctgtaggaacaggagacgttgaagagttgggtgttgtgcctatt
ctttcggggttcaattatacctatggagcggtgtattttgatgtagatggtaatttctac
gtttctgccaatcaaacaggatctgtgtataaaataaataatgtacagactatttctaat
ggtgctatggtttccaatatattcgcttttggtccggcgagtgcaagtaatgatggcgca
cgttgtcctacagcgcctttaccgcaagaagattgtatcaatggggtagatgatgatggt
gatggattggtagattgtgatgatccttcttgttcaggaataagttcttgtccaaccata
acaaccacttcaggaggtaatgatggaggtttagaaagtaatgatagattatctacttta
attaatcagcgaaacttcaacagagcaaatacaaattataaattcgataaatcatcagct
aaaaccattaaaaaaggatttaattacaaacgaaaagatgcctttaccagtaaagatatt
ccgttaaatacgttggtgccattaggtattgtaggggagacttctacgatagaatcttca
ccagcagatttattagcgcttaccaatgcctctgatattttctctgttgattatttaaaa
gagagtgaaacagttagtgctttgatggtgataaaaaccgatgataatgtatatgaacac
agtaagtttatatgtgatcgtttccttggtgctcaattattgtctgtttctacaattcaa
ttacgagagaaagattttattaaatcaattatcaaacaagccgatggcagtattgaattt
gccttgacattttcggcaagagttaacgagaatgatgaatttgtagtagaatctcattgg
aatattgatgcttatgagaagaatacggcctattataattttcaaatatggtctaattcg
gttgatgatttactaaaattaggagatgaaatactaaaccttttagaggctaatagtgca
attgtcgattatagagggtctacaccacctccagtatttgtaagaagcgctagttatgct
aatggtactataaacttacagcttaccaacaataataagagtacgtctattactatggat
ggtggaatgaagaagacagaaaccagtggtacagataacttaaacttagcaacaagtatt
gctacacgagtagaatctattacagtagaaacgggagctttgtttgattttggctttaga
atacaaaacgcacaaggagatacccctgatgatctctttgttgctgatgctccttggggc
ttagatgaatcttctgataatacaacagtagatatctatgaagtgttacaaaacaaagct
agttatgcctatagtggttatagaatagaacgtaatgttcatgctaaaggaacaacagcc
aattacttaggtgtttatcgtgcattgacaccacgttttcaagctgtagatttatctgcc
tatgagaaattatcttttaatgcctctggaacaggagccttagaagttaaacttttaaaa
ggtgatggctctttttacactacagaactcgttttaacagaagaagataaaatgtttgag
attttagcttcagattttaaagatgaaacgaatagtgtagcagattttgcaaacttaaaa
gtggtgctctttaatatgcactcaacggatggaagtgttcaagaaaaagaaatgactatt
tcagaaatagattttaataatagatcagaaatagaagaagaaatcatcgttgaagaagaa
acgagtacaaaggctttgatataccctaacccagttaaagcttcaactaccctgtattat
acctcaagaacagatgacacatataccttagagttattttctctaaacggaattttatta
agtaatcattcgcaagaaggaactcatgcggtagggcagaacgaaattacaatacctcgt
aaagacttgagtcctggaatttatttttacaaattagcaagtagagatcagatatggagc
ggaaagattgttgttaaatga

DBGET integrated database retrieval system