KEGG   Cellulophaga algicola: Celal_0119Help
Entry
Celal_0119        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANAPC4_WD40 DUF1033
Motif
Other DBs
NCBI-ProteinID: ADV47476
JGI: Celal_0119
UniProt: E6X727
Position
135405..136523
Genome map
AA seq 372 aa AA seqDB search
MNSISHQLHQKESGKLLILTLTKTSLVSQSGKREKLRTTQKDFDSHEDALKAFTKKEWKA
LKKGFKYTTQEAEIGEPSLHRYIGGGYTGALSFEATPKGIYTYKNDDEKDVLILIDPLGD
TLEEIALPKQLAWSIAYSPKRNALILDLDHFIYAYDIKNNTFRNLGSKKNSFTSFIAVAI
NSIAFATDDNISIQNNQDKLSYSQNYDTEVINGNIPFCGTLSKDGKLLALHTKVGEIQII
AVNSGLTVHTIKADFEMIDQMEFSKDNILLIAQEHYGTWGMRYFDLSNTKELKFPALEIP
EYTKEVRNFCFSQDQSKLVLVQRTSAYVFDFKAKKFIHSFPLAHVVKSCEIKFIEDKLGV
RTDYGCFSLYKV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaactctatttcacaccaattacatcaaaaagaaagtggaaaattattaattttaaca
ttaactaaaacctccttagtttctcagtctggtaaacgtgagaaattacgaactactcaa
aaagattttgacagtcatgaagatgccttaaaagcgtttacgaaaaaagaatggaaagcc
ttaaaaaaaggctttaagtatacaacgcaagaagcagaaataggtgaacccagtttacat
cggtatattggaggtggctatactggggctttatcatttgaagctacccctaagggaatt
tatacctataaaaacgatgatgaaaaggatgtacttattttaattgatccccttggagat
accctagaagaaatagcattaccaaagcaactagcttggtctattgcgtatagtccaaag
cgaaatgctttaattctagatttagatcactttatttatgcgtatgatattaaaaacaat
acgtttaggaatttaggtagtaaaaaaaacagttttacgagctttattgctgttgccata
aatagcattgcttttgcaacagatgacaatatatccattcaaaataatcaggacaagcta
agctacagtcaaaattacgatactgaggttatcaatggaaacattccgttttgcggcacc
ttatctaaggatggtaaattattagcattgcacactaaagttggcgaaattcagataata
gctgtaaatagtggccttaccgtacatactattaaagccgattttgaaatgattgaccaa
atggaatttagtaaagacaatattttattaattgcacaagagcattatggtacatggggt
atgcgctattttgatctttcaaatactaaagagcttaaatttcctgctttagaaatcccg
gaatacaccaaagaagtaaggaatttctgtttcagtcaagaccaatcaaagttggttctg
gttcaaagaactagcgcctatgtatttgattttaaggctaaaaaattcattcacagtttt
ccgctagcgcatgtggtaaaaagttgtgaaattaaatttatagaagataagcttggtgta
cggacagattatgggtgctttagcctttataaagtataa

DBGET integrated database retrieval system