KEGG   Cellulophaga algicola: Celal_0164Help
Entry
Celal_0164        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7TM-7TMR_HD PUNUT S_tail_recep_bd EXS DUF5493 ETRAMP
Motif
Other DBs
NCBI-ProteinID: ADV47515
JGI: Celal_0164
UniProt: E6X7S2
Position
complement(173778..174329)
Genome map
AA seq 183 aa AA seqDB search
MKTYTITDQKKIEELAKKTKKITIISTVIVLTLITGFTVYLFSEDGAKIPVIPLILVVLL
FTVLFSLLIKQLNDMLFKLSRHRFIRIAEESITIGTSATFMEELNYVQKYFYNRINRFGA
HDDKTFYAHKIKSINQTRKGLQFKVSGLIGDVVTIPNEIDKLHEIKQEINKMMYASNNTL
KIK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgtatacaatcacagatcaaaaaaaaattgaggaattagcgaaaaaaactaaa
aaaatcaccattatttctacagtcattgtactgactttgattactggttttaccgtttat
ttattctcagaagacggagcgaaaattcctgtgatccccttaattctagtcgttttatta
tttacggtacttttttctctactgataaaacaattgaatgatatgctgttcaaattaagt
agacatagatttattaggattgcagaggaatcaattactatcgggacaagcgcaaccttt
atggaggaactaaattatgtgcaaaagtacttctacaaccgcataaaccgctttggtgcg
catgatgataaaaccttttatgcgcataaaattaaatcaatcaatcaaacaagaaaagga
cttcagtttaaagtttctggtttaataggtgacgtggtaaccatacccaatgaaatagat
aagcttcatgaaattaagcaagaaattaataaaatgatgtatgcttcaaataataccttg
aaaataaaatag

DBGET integrated database retrieval system