KEGG   Cellulophaga algicola: Celal_0297Help
Entry
Celal_0297        CDS       T01404                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cao  Cellulophaga algicola
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Celal_0297
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Celal_0297
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Celal_0297
Enzymes [BR:cao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Celal_0297
Exosome [BR:cao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Celal_0297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(324564..325694)
Genome map
AA seq 376 aa AA seqDB search
MIYRNSIFIALLVTLISCKSAVIKEELRPKAKNVILLIADGTGLSQVSSAFYFKKTKPNY
ARFKSIGLIKTSSATEDVTDSAAGATAFSTGEKTYNGAVGVAVDSSHLKTLVEILAPQHV
KTGLIATSSIQHATPASFYAHVLHRSQYEDIALDLVTSDVDFLAGGGRQFLTKRKDGKNL
LAELKVNGFEVDTTALGSFSEIKKHSKMAYLLAEEHMNAVAKGRGDFLPKATELGIEFLN
KDAAKSGFFMMIEGSQVDWGGHSNDADYLISELIDFDDAVGKALDFAEKDGNTLVIVTAD
HETGGFTLASTPKEKEDGTTYDDYKEITGTFSTKGHSATLIPVFAFGPGSEAFNGIYENT
GIFHKIFELTNWKNTK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgatttatagaaatagtatttttatagcccttttagtaacattaatttcctgcaaatct
gcagttattaaagaagagttaagaccaaaagctaagaatgttattcttttaatagcagat
ggtaccggtttgtctcaagtatcctctgcattttattttaaaaagaccaaaccaaattac
gcaaggtttaagtcaatcggacttattaagacctcttctgcaacagaagatgttacagat
tctgctgctggagcaacagctttttcaacaggagaaaagacgtacaatggtgctgttggt
gttgctgtagactcctcgcatttaaaaactttggtagagattttagctccacaacatgtt
aaaaccggattaattgcaacctcgtcaatacaacatgccactccagctagtttttatgcg
catgttttacatagaagccaatatgaagatattgctttagatttagttacttctgatgta
gactttttagccggtggtggaagacaatttcttactaaaagaaaagatgggaaaaattta
ttagcagaattaaaagtaaatggatttgaggtagatacaactgctttgggaagtttttca
gaaattaaaaaacattctaaaatggcttatttattagccgaagagcatatgaatgcggtg
gcaaaaggacgaggagattttttacctaaagcaacagaattaggtatagaatttttgaat
aaagatgctgctaaatctggtttttttatgatgatagaaggttcgcaagtagattgggga
ggtcattctaatgatgctgattatttgatatctgaattaattgattttgatgacgctgta
ggtaaagcgctagattttgcagagaaagatggcaatactttggttattgtaactgcagat
catgaaacaggaggttttacattagcctctaccccaaaggaaaaagaagatggtaccact
tatgacgattataaggagattacaggtacgttttcaaccaaaggacattctgccacttta
attccggtgtttgcttttggtccaggttctgaggcatttaatgggatatatgaaaacacc
ggtatttttcataaaatatttgaactaacaaattggaagaataccaagtaa

DBGET integrated database retrieval system