KEGG   Cellulophaga algicola: Celal_0300Help
Entry
Celal_0300        CDS       T01404                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cao  Cellulophaga algicola
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(328787..329878)
Genome map
AA seq 363 aa AA seqDB search
MISKKHLFYSLCTCLMLSLFFSCGKKVLPIKTSLKNNAAFPIGTAIKIKTLLSDSELQAL
QINNFNSITSASDMKMNKVMPSEGVYYWGGVDSIVKYAKANNQRLFGHNLIWHSSTPKWV
EEKASKDSLWMSKFMEDYIKTYVGRYKGKVAAWDVVNEGLESAGGAIRKTMWYNAIGKDY
IAKAFTYAHEADPNAVLFYNDFNIERDTVKLNATLKLIKELRSQNVPISGIGFQMHTRMD
IPDDIIAHALKEAVKTGLQIHLSEVDIIFNTHNDTRGGGIQLYDELTDEMKNKQAEKYKN
LIKMYRSIVPEKQQYGITFWDFTDRDSWISGFFKMKDWPTIYDENLEPKPAYFSVLEGLN
EKL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgatttctaaaaaacacttgttttactctttgtgcacatgcctaatgctttcactgttt
ttttcttgcgggaagaaggtattaccaattaaaacaagccttaaaaataatgcagccttt
cctataggaaccgcaataaaaattaaaacattattaagcgattcagaattacaagcctta
caaatcaacaatttcaatagtattacatcagcaagtgatatgaagatgaacaaggttatg
cctagtgaaggtgtatattattggggtggagtagatagtattgttaagtatgctaaagcc
aataatcaacggctatttggacacaatttaatttggcatagttcaacaccaaaatgggta
gaagaaaaagcatctaaagatagtttatggatgtctaaatttatggaagattatattaaa
acctatgtggggcgttacaaaggtaaagtagcagcatgggatgtagtaaatgaggggctt
gaatctgcaggaggagccattcggaaaaccatgtggtataatgctattggtaaagattac
attgccaaggcatttacatatgcgcatgaggcagatcctaacgccgttttgttttataac
gattttaatattgaaagagatacggtaaaacttaatgcgacacttaaactaattaaggaa
ttaagaagccaaaacgttccgatttcgggaataggttttcaaatgcatactcgaatggat
attccagacgatattattgcccatgcgctaaaagaagcagtaaaaacaggcttgcaaatt
catctatcagaagttgatattatttttaatacacataatgatactagaggtggaggtatt
caattgtatgatgagcttaccgatgagatgaaaaataaacaagcagaaaagtataaaaac
cttattaaaatgtaccgttctatagttcctgaaaagcaacaatatggtattactttttgg
gattttacagatagagatagctggattagtggtttttttaaaatgaaagattggccaaca
atttatgatgaaaacttagaaccaaaacctgcatattttagtgttttagaaggtttaaat
gaaaaattataa

DBGET integrated database retrieval system