KEGG   Cellulophaga algicola: Celal_0479Help
Entry
Celal_0479        CDS       T01404                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cao  Cellulophaga algicola
Pathway
cao00010  Glycolysis / Gluconeogenesis
cao00051  Fructose and mannose metabolism
cao00562  Inositol phosphate metabolism
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
cao01120  Microbial metabolism in diverse environments
cao01130  Biosynthesis of antibiotics
cao01200  Carbon metabolism
cao01230  Biosynthesis of amino acids
Module
cao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cao_M00002  Glycolysis, core module involving three-carbon compounds
cao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celal_0479
   00051 Fructose and mannose metabolism
    Celal_0479
   00562 Inositol phosphate metabolism
    Celal_0479
Enzymes [BR:cao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Celal_0479
Exosome [BR:cao04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Celal_0479
  Exosomal proteins of bladder cancer cells
   Celal_0479
  Exosomal proteins of melanoma cells
   Celal_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DeoRC
Motif
Other DBs
NCBI-ProteinID: ADV47818
JGI: Celal_0479
UniProt: E6XAX7
Position
complement(568173..568922)
Genome map
AA seq 249 aa AA seqDB search
MRSKIVAGNWKMNKNGTETEALLAELSAKLPDTTAEVMVAPNFVNLAGAVRSLESSTIEV
IAQNMHYAESGAFTGEISADMLQNVGVKTVIIGHSERRAYFGETDEILAKKVIAALAKNM
RIMFCFGEELEDRKSDNHFNVVASQLKNALYSLEANSWKNIVLAYEPVWAIGTGETASPE
QAQEMHAFIRKSITEAYDATIANNVSILYGGSVKPNNAVEIFSKPDVDGGLIGGAALVAD
DFVAIIKAI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtaaaatagttgcagggaattggaaaatgaataagaatggtactgaaactgaa
gcattattagcagaactttctgctaaattaccagatacaacagctgaggtgatggttgcg
ccaaattttgtaaaccttgctggtgcagtacgtagtttagaatcttctactattgaagtt
atagcgcaaaatatgcattatgcagaaagcggagcatttacaggagaaatctctgcagat
atgttacagaatgtaggcgtaaagactgtaattattggtcactcagaaagaagagcttat
tttggggagacagatgagattttggcaaaaaaagtgattgctgcgcttgctaaaaatatg
cgtattatgttttgttttggagaagaattagaagatcgtaaatcagacaatcattttaat
gtagtagcaagtcaacttaaaaatgcgttatattctttagaagcaaactcttggaaaaat
attgttttagcatatgaaccagtttgggctataggtactggagaaacagcatctccggag
caagcacaagaaatgcatgcgtttatccgtaaatctatcacggaagcttatgatgctaca
attgctaataacgtatctatcttatatggaggtagtgttaaaccaaacaatgctgtagag
attttctctaagccagatgtagatggtggtcttattggaggagcagcgttagtggcagat
gattttgttgccattatcaaagcaatctaa

DBGET integrated database retrieval system