KEGG   Cellulophaga algicola: Celal_0515Help
Entry
Celal_0515        CDS       T01404                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cao  Cellulophaga algicola
Pathway
cao00250  Alanine, aspartate and glutamate metabolism
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Celal_0515
Enzymes [BR:cao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Celal_0515
Peptidases [BR:cao01002]
 Cysteine Peptidases
  Family C44
   Celal_0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase OB_RNB
Motif
Other DBs
NCBI-ProteinID: ADV47854
JGI: Celal_0515
UniProt: E6XBL9
Position
complement(606742..608415)
Genome map
AA seq 557 aa AA seqDB search
MCGIVCAFDVKESTEDLRPQLLEMSKKIRHRGPDWSGIFANDKAILAHERLSIVDPASGK
QPLFSKDNKLVLAANGEIYNHRELRKQFEGKYDFQTESDCEVILALYQEKGASFIDEMNG
IFGFAIYDVEKDEYFIARDHMGIIPLYMGWDKNGTFYVASELKALEGVCTKIELFPPGHY
MHSSDGELKQWYTRDWMEYDAVKDNETSIKEIKEALEAAVHRQLMSDVPYGVLLSGGLDS
SVTSAIAKKYAQKRIESDDVADAWYPQLHSFSVGLEGSPDLAAARIVADHIKTIHHEIKF
TIQEGLDAIKDVVYNLETYDVTTIRASTPMYLMARVIKSMGVKMVLSGEGADELFGGYLY
FHKAPNAKEFHEETVRKLSKLHMYDCLRANKSLAAWGIEGRVPFLDKEFMDVAMRINPQD
KMINGERMEKWVVRKAFEDMIPESVAWRQKEQFSDGVGYSWIDTLKEVVAEEVSDEQLAN
AKFRFPLQTPTSKEEFYYRSIFESHYPSDAAALCVPQEASVACSTKIALEWDEAFKNMND
PSGRAVANVHSDAYVKA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagtatgtgcatttgatgtaaaagagagtactgaggatttaagaccacag
ttattagaaatgtcgaaaaaaattagacatagaggaccagactggagtggaatatttgct
aatgataaagcgatattggctcacgaacgtttgtctattgtagatcctgcttcaggaaaa
caacctttgtttagtaaagataataaattagtactagctgctaatggtgaaatatataac
cacagagaattaagaaaacagtttgaaggtaaatatgatttccaaacagaatctgactgt
gaggttatattggctttataccaagaaaaaggagcaagtttcattgatgaaatgaacgga
atttttggtttcgctatatatgatgttgaaaaagatgagtattttatagctagagatcat
atggggatcattcctttatatatgggatgggataaaaacggaacgttttatgttgcttca
gagttaaaagcattagaaggcgtttgtactaaaatagagctttttcctccgggtcattat
atgcatagttctgatggagaattaaagcagtggtacacgcgtgattggatggagtatgat
gcggttaaggataacgagacaagcataaaagaaattaaagaagctttagaagctgcggta
catagacaattaatgtctgatgttccttacggtgtgttactttctggaggtttagattct
tctgtaacctctgcaattgctaagaaatatgctcaaaaaagaatagagtcagatgatgtt
gcagatgcttggtacccgcaattgcactctttttctgtaggactagaaggttctccagat
ttggcagcggcacgtatagttgcagatcatataaaaacaatacatcatgaaataaaattc
acaattcaagaagggttggatgctattaaagatgtagtgtataacttagaaacctatgat
gtaactaccattagagcttcaactcctatgtacttaatggcaagggttattaagtctatg
ggtgttaaaatggtattgtcaggagaaggtgcagatgaattatttggggggtatttatat
ttccataaggcacctaatgccaaagaatttcacgaagaaacagttcgtaagttaagtaag
cttcatatgtatgattgtttgcgtgccaacaaatcattagcagcatggggaatagaaggg
cgtgtgcctttcttagataaggagtttatggatgttgccatgcgtattaaccctcaagat
aaaatgatcaacggagagcgtatggagaaatgggttgttcgtaaagcttttgaagatatg
attccagaaagtgttgcttggagacaaaaagaacaattctctgatggagtagggtatagt
tggatagatacgttaaaagaagttgtagcagaagaggtgtcagatgaacagttagcaaat
gctaaattcagattcccattacagacgccaacatcaaaagaagaattttattaccgttca
atttttgaatcacattacccttcagacgcagcagcactttgtgtgccgcaagaagcatct
gtagcgtgtagtacaaaaattgcattagaatgggatgaggcgtttaagaacatgaacgat
ccatctggtagagcagtagcaaatgtgcattcagatgcgtatgtaaaagcttaa

DBGET integrated database retrieval system