KEGG   Cellulophaga algicola: Celal_0515Help
Entry
Celal_0515        CDS       T01404                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cao  Cellulophaga algicola
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Celal_0515
Enzymes [BR:cao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Celal_0515
Peptidases [BR:cao01002]
 Cysteine Peptidases
  Family C44
   Celal_0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(606742..608415)
Genome map
AA seq 557 aa AA seqDB search
MCGIVCAFDVKESTEDLRPQLLEMSKKIRHRGPDWSGIFANDKAILAHERLSIVDPASGK
QPLFSKDNKLVLAANGEIYNHRELRKQFEGKYDFQTESDCEVILALYQEKGASFIDEMNG
IFGFAIYDVEKDEYFIARDHMGIIPLYMGWDKNGTFYVASELKALEGVCTKIELFPPGHY
MHSSDGELKQWYTRDWMEYDAVKDNETSIKEIKEALEAAVHRQLMSDVPYGVLLSGGLDS
SVTSAIAKKYAQKRIESDDVADAWYPQLHSFSVGLEGSPDLAAARIVADHIKTIHHEIKF
TIQEGLDAIKDVVYNLETYDVTTIRASTPMYLMARVIKSMGVKMVLSGEGADELFGGYLY
FHKAPNAKEFHEETVRKLSKLHMYDCLRANKSLAAWGIEGRVPFLDKEFMDVAMRINPQD
KMINGERMEKWVVRKAFEDMIPESVAWRQKEQFSDGVGYSWIDTLKEVVAEEVSDEQLAN
AKFRFPLQTPTSKEEFYYRSIFESHYPSDAAALCVPQEASVACSTKIALEWDEAFKNMND
PSGRAVANVHSDAYVKA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagtatgtgcatttgatgtaaaagagagtactgaggatttaagaccacag
ttattagaaatgtcgaaaaaaattagacatagaggaccagactggagtggaatatttgct
aatgataaagcgatattggctcacgaacgtttgtctattgtagatcctgcttcaggaaaa
caacctttgtttagtaaagataataaattagtactagctgctaatggtgaaatatataac
cacagagaattaagaaaacagtttgaaggtaaatatgatttccaaacagaatctgactgt
gaggttatattggctttataccaagaaaaaggagcaagtttcattgatgaaatgaacgga
atttttggtttcgctatatatgatgttgaaaaagatgagtattttatagctagagatcat
atggggatcattcctttatatatgggatgggataaaaacggaacgttttatgttgcttca
gagttaaaagcattagaaggcgtttgtactaaaatagagctttttcctccgggtcattat
atgcatagttctgatggagaattaaagcagtggtacacgcgtgattggatggagtatgat
gcggttaaggataacgagacaagcataaaagaaattaaagaagctttagaagctgcggta
catagacaattaatgtctgatgttccttacggtgtgttactttctggaggtttagattct
tctgtaacctctgcaattgctaagaaatatgctcaaaaaagaatagagtcagatgatgtt
gcagatgcttggtacccgcaattgcactctttttctgtaggactagaaggttctccagat
ttggcagcggcacgtatagttgcagatcatataaaaacaatacatcatgaaataaaattc
acaattcaagaagggttggatgctattaaagatgtagtgtataacttagaaacctatgat
gtaactaccattagagcttcaactcctatgtacttaatggcaagggttattaagtctatg
ggtgttaaaatggtattgtcaggagaaggtgcagatgaattatttggggggtatttatat
ttccataaggcacctaatgccaaagaatttcacgaagaaacagttcgtaagttaagtaag
cttcatatgtatgattgtttgcgtgccaacaaatcattagcagcatggggaatagaaggg
cgtgtgcctttcttagataaggagtttatggatgttgccatgcgtattaaccctcaagat
aaaatgatcaacggagagcgtatggagaaatgggttgttcgtaaagcttttgaagatatg
attccagaaagtgttgcttggagacaaaaagaacaattctctgatggagtagggtatagt
tggatagatacgttaaaagaagttgtagcagaagaggtgtcagatgaacagttagcaaat
gctaaattcagattcccattacagacgccaacatcaaaagaagaattttattaccgttca
atttttgaatcacattacccttcagacgcagcagcactttgtgtgccgcaagaagcatct
gtagcgtgtagtacaaaaattgcattagaatgggatgaggcgtttaagaacatgaacgat
ccatctggtagagcagtagcaaatgtgcattcagatgcgtatgtaaaagcttaa

DBGET integrated database retrieval system