KEGG   Cellulophaga algicola: Celal_0960Help
Entry
Celal_0960        CDS       T01404                                 

Definition
aspartate/glutamate/uridylate kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cao  Cellulophaga algicola
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cao01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cao00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1102409..1103170
Genome map
AA seq 253 aa AA seqDB search
MKKIRVLLKVGSNTLTKETNHISRGKVEDIGRQIEHLKDTHEFIIVSSGAIAAARQFVKL
EHNGEDINVKQALASIGQPHLMRIFQENFRELGLFTSQCLLSYLDFENPKSKSNIKNTID
VLVANNFIPIINENDTVATDEIQFGDNDKLAALTAALLKVDLLIIATNTDGVYTKKSLTE
IMPETIKEVIHLNELINEVGDHKSTHGTGGMQSKIEAATIAKAANIETWIINGIKDNFIT
DAMNGKSNFTKIK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagattcgcgtattattaaaagtgggttcaaatactttaactaaagaaacaaat
catatttctcgaggaaaagtagaagatattgggcgtcaaatagagcacttaaaagacaca
catgaatttattatcgtgagctctggtgcaattgctgcagcacgacaatttgtaaaatta
gagcacaatggggaagatatcaatgtaaaacaggcattagcttctattggtcagccccac
ttaatgcgtattttccaagagaattttcgtgaattagggttgtttacttcacaatgtttg
ttatcctatttagattttgaaaacccaaaatctaaatcgaatattaaaaatactatagac
gttttagtcgcgaataattttatcccaattattaacgagaatgacaccgtagctaccgat
gaaatacagtttggcgacaatgataaattagccgcattaaccgcagctttattaaaagtt
gatttactgatcattgccaccaataccgatggagtttacacgaaaaaatcacttacggaa
ataatgccagaaacgattaaggaggtcatccatttaaatgaattgattaatgaagttggc
gatcataagtctacacacggcactggcggtatgcaatctaaaatagaagcagcaaccatt
gcaaaagctgctaatattgaaacatggatcatcaacggaataaaagataattttatcacg
gatgccatgaatggtaaaagtaattttacaaaaataaagtaa

DBGET integrated database retrieval system