KEGG   Cellulophaga algicola: Celal_1629Help
Entry
Celal_1629        CDS       T01404                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cao  Cellulophaga algicola
Pathway
cao00860  Porphyrin and chlorophyll metabolism
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
cao01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Celal_1629
Enzymes [BR:cao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Celal_1629
Exosome [BR:cao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Celal_1629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADV48938
JGI: Celal_1629
UniProt: E6XBT6
Position
complement(1875516..1876502)
Genome map
AA seq 328 aa AA seqDB search
MYPLIRNRRLRTSEAIRSLVRETILTPSDFLVPLFVVEGKGVKEEIASMPNYFRLSLDTL
EKEVKELWSMGLCSVLLFVKVPDKLKDNKGTEALNAAGLMQRAIKTVKNACPDMLVMTDV
ALDPYSSFGHDGIVANGQILNDESAELLAEMSISHAQAGADFVAPSDMMDGRILTIREAL
EDEGFINTGIMSYSAKYASAFYGPFRDALDSAPVDQENVPKNKSTYQMDYANRFEAIRET
QMDIEEGADIVMVKPGLCYLDIVREIKNEVDVPVAVYQVSGEYAMLKAAAEKGWLDHDAV
MIEQLMAIKRAGANIIASYFAKDAVKLM
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtacccattaatacgaaatagaagacttagaacatcagaggcaatacgaagcttagta
cgcgaaactatattaacgccgagtgactttctggtaccgctttttgtggtagaaggtaaa
ggtgtaaaagaagaaatagcttctatgccaaattactttcggctaagtttagatacttta
gaaaaagaagtaaaggaactatggagcatgggtctatgttctgttttactttttgtaaaa
gttcctgataaattgaaagacaataaaggaaccgaagcattaaatgctgcgggattaatg
cagcgcgctattaaaaccgtaaaaaatgcgtgcccagatatgttagtgatgacagatgtg
gctttagatccgtattcttcttttggccatgatggaattgttgctaatggacaaatacta
aatgatgaatctgccgagcttttggcagagatgagtatttcacatgcacaagcaggagca
gattttgtagcccctagtgatatgatggacggaagaatacttactattcgtgaagcctta
gaggatgaaggttttatcaataccggtattatgagttacagcgccaaatatgctagtgcc
ttttacggcccttttagagatgctttagattctgctcctgtagatcaggaaaatgttccc
aaaaataaaagcacttatcagatggattatgccaaccgttttgaagccatacgagaaaca
caaatggacattgaagaaggagcagatattgtcatggtaaagccaggattgtgttattta
gatattgttcgtgaaataaaaaatgaagtagatgttcctgttgcagtataccaagtaagc
ggcgagtatgccatgctaaaagctgctgcagagaaaggttggctagaccatgacgccgta
atgattgagcaattaatggccatcaaaagagctggagcaaatattatagcaagctacttt
gcaaaggatgccgtaaaattaatgtaa

DBGET integrated database retrieval system