KEGG   Cellulophaga algicola: Celal_1751Help
Entry
Celal_1751        CDS       T01404                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cao  Cellulophaga algicola
Pathway
cao00230  Purine metabolism
cao01100  Metabolic pathways
Module
cao_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Celal_1751
Enzymes [BR:cao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Celal_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 AAA_22 cobW CPT RsgA_GTPase AAA Herpes_BLRF2 Viral_helicase1 AAA_19
Motif
Other DBs
NCBI-ProteinID: ADV49052
JGI: Celal_1751
UniProt: E6XCR3
Position
1998721..1999305
Genome map
AA seq 194 aa AA seqDB search
MKGGKLIIFSAPSGSGKTTIVRHLLEKNDLNLAFSISATSRPRRGKEKNGEHYYFISLSE
FKRHIKNDDFLEWEEVYRDNFYGTLKTEVERLWAEGKNVIFDIDVVGGLRIKKKFPEQTL
AVFVKPPSVDELKIRLKKRSTESDDKINMRIAKASVELATAPQFDRIIKNYDLDTALDES
YKLVQEFLASKKES
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtggaaagcttattatattttctgcaccttctggaagtgggaaaacaacaatc
gtcaggcatttgttagagaaaaacgatttaaacctcgctttttcaatttctgcaacgtct
agaccaagaagaggaaaagaaaaaaacggagagcattattattttatttcactttcagaa
tttaagagacatattaaaaatgatgactttttagaatgggaagaggtatacagggataat
ttttatggaacgcttaagacggaagtagaacgtttatgggcagaaggtaaaaatgtaatt
tttgatattgatgttgttggaggtttaagaataaaaaagaagttcccggagcaaacttta
gcggtatttgtaaaaccgccgagtgtagatgaacttaaaataagattaaaaaaacgcagt
acagaaagtgatgataaaataaacatgcgtatagctaaagcttctgtagaattagcaact
gcaccacagtttgatagaatcattaaaaattacgatttagatactgctttagatgaatcc
tataaattggtacaagaatttttagcatctaaaaaggaatcgtaa

DBGET integrated database retrieval system