KEGG   Cellulophaga algicola: Celal_1833Help
Entry
Celal_1833        CDS       T01404                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cao  Cellulophaga algicola
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cao00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2099780..2100724
Genome map
AA seq 314 aa AA seqDB search
MTTTNNYAGIPDKYAQLETAKVVLIPVPYDGTSTWRKGADKGPEAFLKASENMEIYDIET
DTEVYQQGIYLADAVTENSSPEAMVEAVHAVTKDYIKRNKFVTLFGGEHSISIGTIRAFN
ECFNNLTVLHIDAHADLRESYDGSKCNHACAVHEASQTTNLIQVGIRSMDAIEKTFMDEE
KTFFAHDMVNDEYWMDTVIELMTENVLITFDLDALDPSILSSTGTPEPGGLFWYETLEFL
KRVFAEKNVVGFDIVELCPNEVDKTSDFLAAKLYYKMLSYKFMGEAADEAYDNAYDIDLK
QGATNNSKFEDDED
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaactaacaattacgcgggaatacctgataagtatgcgcaattggaaacggca
aaggtggttttaataccagtgccttacgacggaacaagtacatggagaaaaggagcagat
aaagggccagaagcctttttgaaagcatctgaaaacatggaaatttatgatattgaaaca
gatacagaagtgtatcaacaaggtatttatttagcagatgctgtaaccgaaaatagctcg
ccagaagctatggtagaagcagtacatgcggtgaccaaagactatatcaaaagaaataaa
tttgtaacgttatttggaggggaacactctatttctataggtactattagagcgtttaat
gaatgttttaataacttaaccgtattgcatatagatgcgcatgcagatctgcgtgaatca
tatgatggcagtaagtgtaaccatgcttgtgctgttcatgaagctagccaaacaacaaat
cttattcaagtaggtatccgtagtatggatgctatcgagaaaacgtttatggacgaagaa
aaaacattctttgcgcatgatatggttaacgatgagtattggatggatacggttatagaa
ttgatgacagaaaatgtattaataacatttgatttagatgcattagacccaagtatatta
tcatctacaggaactcctgaaccaggaggcctattttggtatgaaactttagaattcttg
aagagagtttttgctgaaaagaatgttgtaggttttgatattgttgagctttgccctaat
gaagtagataaaacttcagatttcttagcggctaagttgtattataaaatgttaagctat
aaatttatgggtgaagctgcagatgaagcttacgataacgcatatgatatagatttaaaa
caaggcgctactaataattcaaaatttgaagatgacgaagactaa

DBGET integrated database retrieval system