KEGG   Cellulophaga algicola: Celal_1833Help
Entry
Celal_1833        CDS       T01404                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
cao  Cellulophaga algicola
Pathway
cao00330  Arginine and proline metabolism
cao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Celal_1833
Enzymes [BR:cao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Celal_1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADV49134
JGI: Celal_1833
UniProt: E6XE53
Position
2099780..2100724
Genome map
AA seq 314 aa AA seqDB search
MTTTNNYAGIPDKYAQLETAKVVLIPVPYDGTSTWRKGADKGPEAFLKASENMEIYDIET
DTEVYQQGIYLADAVTENSSPEAMVEAVHAVTKDYIKRNKFVTLFGGEHSISIGTIRAFN
ECFNNLTVLHIDAHADLRESYDGSKCNHACAVHEASQTTNLIQVGIRSMDAIEKTFMDEE
KTFFAHDMVNDEYWMDTVIELMTENVLITFDLDALDPSILSSTGTPEPGGLFWYETLEFL
KRVFAEKNVVGFDIVELCPNEVDKTSDFLAAKLYYKMLSYKFMGEAADEAYDNAYDIDLK
QGATNNSKFEDDED
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaactaacaattacgcgggaatacctgataagtatgcgcaattggaaacggca
aaggtggttttaataccagtgccttacgacggaacaagtacatggagaaaaggagcagat
aaagggccagaagcctttttgaaagcatctgaaaacatggaaatttatgatattgaaaca
gatacagaagtgtatcaacaaggtatttatttagcagatgctgtaaccgaaaatagctcg
ccagaagctatggtagaagcagtacatgcggtgaccaaagactatatcaaaagaaataaa
tttgtaacgttatttggaggggaacactctatttctataggtactattagagcgtttaat
gaatgttttaataacttaaccgtattgcatatagatgcgcatgcagatctgcgtgaatca
tatgatggcagtaagtgtaaccatgcttgtgctgttcatgaagctagccaaacaacaaat
cttattcaagtaggtatccgtagtatggatgctatcgagaaaacgtttatggacgaagaa
aaaacattctttgcgcatgatatggttaacgatgagtattggatggatacggttatagaa
ttgatgacagaaaatgtattaataacatttgatttagatgcattagacccaagtatatta
tcatctacaggaactcctgaaccaggaggcctattttggtatgaaactttagaattcttg
aagagagtttttgctgaaaagaatgttgtaggttttgatattgttgagctttgccctaat
gaagtagataaaacttcagatttcttagcggctaagttgtattataaaatgttaagctat
aaatttatgggtgaagctgcagatgaagcttacgataacgcatatgatatagatttaaaa
caaggcgctactaataattcaaaatttgaagatgacgaagactaa

DBGET integrated database retrieval system