KEGG   Cellulophaga algicola: Celal_2027Help
Entry
Celal_2027        CDS       T01404                                 

Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cao  Cellulophaga algicola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celal_2027
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celal_2027
  Amino acid metabolism
   00310 Lysine degradation
    Celal_2027
Enzymes [BR:cao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Celal_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2310796..2312016
Genome map
AA seq 406 aa AA seqDB search
MILEMKVPSPGESITEVEIAAWLVQDGDYVEKDQAIAEVDSDKATLELPAEESGIITLKA
EEGDAVAVGEVVCLIDTSAEKPSGASKAAAPKEEVKETPKEEKKAPQPVQAKETYVSGVA
SPAAKKILAEKGMEAGAVKGTGKDGRITKEDAVQAVPSMGTPTGGKRGESRSKLSMLRRK
VAERLVSVKNETAMLTTFNEVDMSPIFELRNQHKESFKSKHGVGLGFMSFFTLAVVRALE
LYPTVNSMIDGKEMITYDFCDISIAVSGPKGLMVPVIRNAENLTFRGVEAEVKRLAIRAR
EGEITVNEMTGGTFTITNGGVFGSMLSTPIINPPQSAILGMHNIVERPIVRNGEIVAAPI
MYLALSYDHRIIDGKESVGFLVAIKEALENPVELLMDGNVMKALEL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatgaaagttccttcaccaggggaatctataacagaagttgaaattgct
gcttggttagttcaagacggagattatgtagaaaaagatcaagcaattgcagaagtagat
tctgataaagcaaccttagaattacctgctgaagaaagtggtattatcactttgaaagca
gaagagggtgatgctgttgcagtaggtgaagtggtttgtttaattgatacgagtgcagaa
aaaccttctggcgcatcaaaagctgctgctccaaaagaggaagtgaaagaaactcctaaa
gaggaaaagaaagcaccacagcctgtacaagcaaaagaaacgtatgtatctggagtagca
tctcctgcggcaaagaaaatattagcagaaaaaggaatggaagctggtgcggtaaaaggt
actggtaaagatggtagaattactaaagaagatgcagttcaagcagtaccttctatggga
acacctactggaggaaaaagaggagaaagcaggtctaaattgtcaatgttacgtagaaaa
gtagcagagcgtttagtgtctgttaagaatgaaacggctatgttaactacttttaatgaa
gtagatatgtctcctatttttgaattgagaaatcaacataaagaatcattcaaaagtaaa
catggtgtagggcttggctttatgtctttctttacgcttgcagtggttagggctttagag
ctttatccaacagtgaactctatgattgatggaaaagaaatgattacctatgatttctgt
gatattagtatagcggtttcaggtccaaaaggattaatggttcctgtaattagaaatgca
gaaaacttaacctttagaggggtagaagcagaggttaaaagattagcgattcgtgctaga
gaaggagaaatcacagttaatgaaatgacaggtggtacctttactattacaaatggtggt
gtctttggttcaatgttatctacaccaattataaatcctccgcaaagtgctattttagga
atgcacaatattgttgagcgtcctattgttcgtaatggagaaatagtagctgcaccaata
atgtatcttgcattatcatatgatcacagaataattgatggtaaagaatctgtaggtttc
ttagtcgcaattaaagaagcattagaaaatccagtagaattattaatggatggcaatgta
atgaaagcattagaattgtaa

DBGET integrated database retrieval system