KEGG   Cellulophaga algicola: Celal_2027Help
Entry
Celal_2027        CDS       T01404                                 

Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cao  Cellulophaga algicola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celal_2027
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celal_2027
  Amino acid metabolism
   00310 Lysine degradation
    Celal_2027
Enzymes [BR:cao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Celal_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2310796..2312016
Genome map
AA seq 406 aa AA seqDB search
MILEMKVPSPGESITEVEIAAWLVQDGDYVEKDQAIAEVDSDKATLELPAEESGIITLKA
EEGDAVAVGEVVCLIDTSAEKPSGASKAAAPKEEVKETPKEEKKAPQPVQAKETYVSGVA
SPAAKKILAEKGMEAGAVKGTGKDGRITKEDAVQAVPSMGTPTGGKRGESRSKLSMLRRK
VAERLVSVKNETAMLTTFNEVDMSPIFELRNQHKESFKSKHGVGLGFMSFFTLAVVRALE
LYPTVNSMIDGKEMITYDFCDISIAVSGPKGLMVPVIRNAENLTFRGVEAEVKRLAIRAR
EGEITVNEMTGGTFTITNGGVFGSMLSTPIINPPQSAILGMHNIVERPIVRNGEIVAAPI
MYLALSYDHRIIDGKESVGFLVAIKEALENPVELLMDGNVMKALEL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatgaaagttccttcaccaggggaatctataacagaagttgaaattgct
gcttggttagttcaagacggagattatgtagaaaaagatcaagcaattgcagaagtagat
tctgataaagcaaccttagaattacctgctgaagaaagtggtattatcactttgaaagca
gaagagggtgatgctgttgcagtaggtgaagtggtttgtttaattgatacgagtgcagaa
aaaccttctggcgcatcaaaagctgctgctccaaaagaggaagtgaaagaaactcctaaa
gaggaaaagaaagcaccacagcctgtacaagcaaaagaaacgtatgtatctggagtagca
tctcctgcggcaaagaaaatattagcagaaaaaggaatggaagctggtgcggtaaaaggt
actggtaaagatggtagaattactaaagaagatgcagttcaagcagtaccttctatggga
acacctactggaggaaaaagaggagaaagcaggtctaaattgtcaatgttacgtagaaaa
gtagcagagcgtttagtgtctgttaagaatgaaacggctatgttaactacttttaatgaa
gtagatatgtctcctatttttgaattgagaaatcaacataaagaatcattcaaaagtaaa
catggtgtagggcttggctttatgtctttctttacgcttgcagtggttagggctttagag
ctttatccaacagtgaactctatgattgatggaaaagaaatgattacctatgatttctgt
gatattagtatagcggtttcaggtccaaaaggattaatggttcctgtaattagaaatgca
gaaaacttaacctttagaggggtagaagcagaggttaaaagattagcgattcgtgctaga
gaaggagaaatcacagttaatgaaatgacaggtggtacctttactattacaaatggtggt
gtctttggttcaatgttatctacaccaattataaatcctccgcaaagtgctattttagga
atgcacaatattgttgagcgtcctattgttcgtaatggagaaatagtagctgcaccaata
atgtatcttgcattatcatatgatcacagaataattgatggtaaagaatctgtaggtttc
ttagtcgcaattaaagaagcattagaaaatccagtagaattattaatggatggcaatgta
atgaaagcattagaattgtaa

DBGET integrated database retrieval system