KEGG   Cellulophaga algicola: Celal_2028Help
Entry
Celal_2028        CDS       T01404                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cao  Cellulophaga algicola
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2312093..2313445)
Genome map
AA seq 450 aa AA seqDB search
MFSNTTIKKTYFLILLTLFISCSTKSEYTTLAEDLTNAELQSTLIKLSGNLNYYILPNST
DYSKIPSDPKNPITEEKVLLGQLLFHETGIGLEGKTETNKETYSCASCHHSAAGFQSGIQ
QGIGDGGMGFGIAGESRIIDPLYTEDMIDVQPIKSPTVLNSAYQKLMLWNGQFGATSKNI
GTEANWTEGTPKAVNQMGFEGVETQAIAGLSVHRMALDKAFCDANEYSSLFDKAFPDVAI
TERYSLVYAGLAIAAYERTILSNDTNFQNWLKGDLDAMTPTEKKGALLFFGKAKCYQCHN
GPALNSDEFYALGMKDLEGPNVHGIIDDVTKKGRGGFTNKTSDNYKFKVPQLYNLTDVQF
FGHGGSFTSIKEVIAYKNIATHENTEVSTSELSGKFSPLHLSEEEVDLIAAFIETSLSDK
NLNRYTPGALPTGLCFPNADPSSRADMHCN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaaataccactataaagaaaacctacttccttatattacttaccttatttatt
agctgttctacaaaaagcgaatacacaacattagcagaagacttaacaaatgctgaatta
caaagtacattaataaagctttccggaaatttaaactactacatacttcctaatagtaca
gattatagcaaaattccgtcagaccctaaaaatccaattacagaggagaaagtattatta
ggccaattattatttcatgaaaccggaattggcttagaaggaaaaacagaaacgaataaa
gaaacttattcttgcgctagctgccaccatagtgctgcaggcttccaaagtggaatacaa
caaggtataggagatggaggaatgggatttggaattgctggtgaatctagaatcatagat
cctttatatacagaagacatgattgatgtacaacctataaaatctccaacggtattaaac
tcagcctatcaaaaattaatgttgtggaatggacaatttggcgcaactagcaaaaacata
ggaaccgaagctaattggaccgaaggaacaccaaaagccgtaaaccaaatgggctttgaa
ggcgtagaaacccaagcgatagccggattatctgttcatagaatggccttagataaagct
ttttgcgacgctaatgagtatagtagtctttttgataaagcctttccagatgttgctatt
acagaaagatactcccttgtatatgcgggtttagcaattgccgcctacgaaagaacaatc
ttatctaacgatacaaattttcaaaactggcttaaaggcgaccttgatgctatgactcca
acagaaaaaaaaggagctcttttattttttggaaaagcaaagtgttaccaatgccacaat
ggacccgcactaaactctgatgaattttacgccttgggtatgaaagacctagaaggccca
aatgtacatggtattattgatgacgttaccaaaaaaggccgtggaggtttcactaacaaa
acctctgataattataaatttaaagttccccaactttataacttaacagatgttcagttt
tttggacacggaggaagcttcacttctatcaaagaagttatagcatacaagaacattgct
acacatgaaaatacagaagtttctacctccgaattatcgggtaaattttcccctttacat
ttaagcgaagaagaagtagaccttattgcagcattcattgaaaccagtttatccgataaa
aatttaaatagatacacccctggcgcgttgcctacaggattatgcttccctaatgcagac
ccaagctctagagcagatatgcattgtaattaa

DBGET integrated database retrieval system