KEGG   Cellulophaga algicola: Celal_2074Help
Entry
Celal_2074        CDS       T01404                                 

Definition
holliday junction DNA helicase subunit ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cao  Cellulophaga algicola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cao00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Celal_2074
Enzymes [BR:cao01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Celal_2074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2372759..2373340
Genome map
AA seq 193 aa AA seqDB search
MIHHLKGKLVEKNPTHVVIECGGVGYFVNISLHTFSKITDAENIQLFTHLQVKEDSHTLF
GFSEKSEREIFRLLVSVSGIGASIARTMLSSMSPMQIRDAIATANVSAIQSIKGIGAKTA
QRVILDLKDKILKIYDIDEVSSISNNTNKDEALSALEVLGFIRKQSEKIVDKVLAQDASL
SVEDIIKLSLKNL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatacatcacttgaaaggaaagctagttgaaaaaaatcctactcatgtggtgatagaa
tgtggtggagtaggttattttgtaaatatatctcttcatacgttttcgaaaataacagat
gcagaaaacattcagttatttacccatcttcaagtaaaagaagacagtcatactttattt
ggtttttcggaaaaatctgagcgggaaattttccgtttattagtctctgtttctggtata
ggcgcaagtattgcacgtactatgttgtcttctatgtcgcctatgcaaattagagatgca
attgctacggctaacgtttctgctatccaatcgataaaaggtattggtgctaaaacggca
caaagagttattctggatcttaaagataaaatattaaaaatctacgatattgatgaagtt
tcgtcaatttcaaacaatacaaataaagatgaagcgttatctgctttagaagttcttggt
tttatacgtaaacaatcagaaaagattgtagacaaagttttagctcaagatgcttcacta
agtgtggaagacattataaagctttcgcttaaaaatttgtaa

DBGET integrated database retrieval system