KEGG   Cellulophaga algicola: Celal_2211Help
Entry
Celal_2211        CDS       T01404                                 

Definition
UDP-n-acetylmuramoyl-l-alanyl-d-glutamate--2,6-diaminopimelateligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cao  Cellulophaga algicola
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Celal_2211
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Celal_2211
Enzymes [BR:cao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Celal_2211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2525346..2526809
Genome map
AA seq 487 aa AA seqDB search
MRALKDILFGVSITAVSGSTSVMVNSICFDSRIVTMGDVFVAIKGTITDGHEYIEKAIAL
GAKTIICETMPVTIVDDVTYVEVDNGNKALAIMASNFYDNPSKNLKLVGVTGTNGKTTIS
SLLYQLFKKAGFKVGLISTIKIMVDDTEYKTSHTTPDALTINHHLKLMNDVGVEFCFMEV
SSHGIHQKRTEGLAFEGAIFTNLSHDHLDYHKTFAEYRDTKKLLFDNLPKKAFVLTNVDD
KNGLVMLQNTKARKYTYALKTYADYKAQILENQFNGQLLKIDGSEVWSKLIGDFNAYNML
AIYGTAQLLGLEKLEILRLLSELENVDGRFQYFISKERITAIVDYAHTPDALKNVLDTIN
KLRTGNENVITVVGCGGDRDRSKRPVMGHIASEMSTTTIFTSDNPRTENPDEILKEIEAG
VEVQNVRKTLTIESREQAIKTACQLANSNDIILIAGKGHETYQEINGVRAHFDDYEMVQN
LLKALNK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagagcacttaaagacatattgtttggggtaagtattactgcggttagcggttctacc
tctgttatggtaaattctatttgctttgattcgcgtattgtgaccatgggtgatgttttt
gttgctataaaaggaaccattacagatgggcatgaatatatagaaaaagctatagcactt
ggagcaaagaccataatttgtgagacaatgccagtaacaattgttgacgatgttacttat
gttgaagttgataatggaaacaaggctttggcgattatggcatctaatttttatgacaat
ccgtctaaaaatttaaaacttgttggggttacaggaacaaatggtaaaacaaccataagt
agcttgttgtatcagttatttaagaaagcaggttttaaagtggggcttatttctacgata
aaaatcatggtagatgatacggaatataaaacaagccatactacgccagatgctttaact
ataaatcatcatttaaaattgatgaatgatgtaggggttgagttttgttttatggaagtg
agttctcatggaatccatcaaaaaagaacagaaggtttggcttttgagggggctattttc
acgaatttatctcatgaccatttagattatcataaaacctttgcggagtatagggatact
aaaaaattactttttgataaccttcctaagaaggcttttgtacttactaatgttgatgat
aaaaacggcttggtaatgttgcagaatacaaaggcaagaaaatacacctatgcgctaaaa
acgtatgccgattataaagctcaaatattagagaatcaatttaatggacagttattaaaa
attgacggtagtgaggtttggtcaaaattaataggagattttaatgcctataatatgtta
gcaatttatggtactgcacaattattaggtttagagaagttagaaatattaagactatta
agtgagctagaaaatgttgatggtagatttcaatattttatatctaaagaaagaattacg
gcaattgtagattatgcgcatacgccagatgcacttaagaatgtgcttgatacaataaat
aaattacgaacgggaaatgaaaacgtaataaccgttgtgggttgtggcggggatagagat
aggtctaaacgtccggttatggggcatattgcatcagaaatgagtactacgacaatcttt
acttcagataatccaagaaccgagaatccagatgaaatactcaaagagattgaagcaggt
gtagaggttcaaaatgtaagaaaaacactgacaatcgagagtagggagcaagcaataaaa
acagcttgccagttagcgaattctaatgatattattttaatagcaggaaaagggcatgaa
acctatcaagaaataaatggggtaagggcacattttgacgactatgaaatggttcagaat
ctattgaaggcattaaataaataa

DBGET integrated database retrieval system