KEGG   Cellulophaga algicola: Celal_2349Help
Entry
Celal_2349        CDS       T01404                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cao  Cellulophaga algicola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celal_2349
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celal_2349
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celal_2349
Enzymes [BR:cao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celal_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2671598..2672362)
Genome map
AA seq 254 aa AA seqDB search
MNRINQKMQEDKKLLSIYFTAGYPSLNDTVKIIQDLEASGIDMIEIGLPFSDPLADGPTI
QNSSTAALKNGMTTNLLFEQLKDIRKSVSIPLILMGYFNPMLQYGVEAFCKKCAEIGIDG
LIMPDLPLDVYQDEYEAIFKKYDLKNIFLITPQTSDNRIQQIDTASDAFIYMVSSASVTG
SKSGFGTEQTTYFNRIGAMNLKNPQIVGFGINNAETFQQATAHAKGAIIGSAFIKHLTEK
GPEAIPEFVRTIRA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaataaaccaaaaaatgcaagaggataaaaaacttttgtccatatatttcacc
gcaggatacccatctttaaatgatactgtaaaaattattcaggatttagaagctagtggt
attgacatgatagaaataggattaccttttagtgatcctttagcagatggccctactatt
caaaatagttccacggctgctcttaagaatgggatgactacaaatttactttttgagcaa
ttgaaagacattcgaaaatcggtttcaatacctttaattctaatgggctattttaatcct
atgttacaatacggcgtagaagctttttgcaaaaaatgtgcagaaatagggattgatggg
ttgattatgccggatttacctttagatgtgtatcaagacgaatatgaagccatttttaaa
aaatatgatttaaaaaatatctttttaattacgccgcaaacaagtgataaccgcattcaa
caaattgacacggcttctgatgcttttatctatatggtaagttcggctagtgttaccggt
tctaaatcaggatttggaacggaacaaactacttattttaatcgcattggtgctatgaat
cttaaaaacccacaaattgtaggttttggaattaataatgcagaaacttttcagcaagct
acagcgcatgcaaaaggcgctattattggttctgcatttataaaacatttaaccgaaaaa
ggccctgaggcaattcctgaatttgtccgtacaattagagcatag

DBGET integrated database retrieval system