KEGG   Cellulophaga algicola: Celal_2350Help
Entry
Celal_2350        CDS       T01404                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cao  Cellulophaga algicola
Pathway
cao00260  Glycine, serine and threonine metabolism
cao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
cao01130  Biosynthesis of antibiotics
cao01230  Biosynthesis of amino acids
Module
cao_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celal_2350
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celal_2350
Enzymes [BR:cao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Celal_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADV49641
JGI: Celal_2350
UniProt: E6X7F9
Position
complement(2672366..2673547)
Genome map
AA seq 393 aa AA seqDB search
MNYNATEKGYYGAFGGAYIPEMLYPNVEELRQNYLKIMAEPDFKEEFDQLLKDYVGRPSP
LYFAKRLSEKYNTKVYLKREDLNHTGAHKINNTIGQILMAKRLNKTRIIAETGAGQHGVA
TATVCALMGMKCVVYMGEIDIARQAPNVARMKMLGAEVRPALSGSRTLKDATNEAIRDWI
NNPVDTHYIIGSAIGPHPYPDMVTRFQSIISEEIKWQLKEKEGRENPDYVVACIGGGSNA
AGTYYHFLHEPEVGIIAVEAAGKGINSGESAATSALGKEGVIHGCKTLLMQTNDGQITEP
YSISAGLDYPGVGPMHAHLYTSGRGEFYSATDDEAMKSGLELTQLEGIIPAIETSHALAI
FKHRTFKSDDVVVISLSGRGDKDLDNYIKYFNL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaattataacgcaactgaaaaaggatactacggagcatttggtggagcatacatccca
gaaatgctatacccaaacgtggaggagctacgccaaaactacctaaaaataatggcggaa
ccagattttaaggaagaatttgatcagcttttaaaagattacgtaggcagaccttcgcct
ttgtattttgcaaagcgactttcagaaaaatacaacactaaggtttacttaaaacgtgag
gacctaaaccatactggggcgcacaaaataaataacactattggccaaatattaatggca
aaacgcttaaacaaaaccagaattattgccgaaactggcgctgggcaacacggtgttgct
actgctactgtttgcgcattaatgggaatgaagtgtgtggtgtatatgggagagatagat
attgcgcgtcaagcaccaaatgtagcacgtatgaaaatgcttggtgccgaagttagaccc
gctttatctggcagcagaactttaaaagatgctaccaatgaagctatccgtgattggatc
aacaacccagtagatacccattacattattggttcggctattggcccgcacccctatcct
gatatggtcactcgttttcaatctattatttctgaagaaataaaatggcagttaaaagaa
aaagaagggcgagaaaatccagattatgtagttgcttgtattggcggcggtagtaatgct
gcaggaacctattatcattttttacatgaaccagaagttggtatcattgcggtagaagct
gctggaaaaggaattaattctggcgaaagtgcagctacatctgctttaggaaaagaaggt
gttattcatggttgcaagacgctattgatgcaaacaaatgacggacagattacagagcca
tattctatatctgcagggctagattacccaggcgttggacctatgcatgcgcacttatat
acatctggccgtggagaattttattctgctacagacgatgaagctatgaaatctggtttg
gaattaacacagctagaaggaataatccctgctatagaaacgagccacgccttagccata
tttaaacatagaacctttaaatctgacgatgttgtagtcatcagtctatctggtcgtggt
gataaggatttagataattatataaaatatttcaatttgtaa

DBGET integrated database retrieval system