KEGG   Cellulophaga algicola: Celal_2352Help
Entry
Celal_2352        CDS       T01404                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cao  Cellulophaga algicola
Pathway
cao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
cao01130  Biosynthesis of antibiotics
cao01230  Biosynthesis of amino acids
Module
cao_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celal_2352
Enzymes [BR:cao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Celal_2352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ADV49643
JGI: Celal_2352
UniProt: E6X7G1
Position
complement(2674315..2675103)
Genome map
AA seq 262 aa AA seqDB search
MNILDKIVLDKRKEVALRKALIPVSQLEQSVLFARPENSLATALRNSASGIIAEHKRRSP
SKSEINQSLNVQDVATGYEAAGVCGMSVLTDAKYFGGSLDDLLIARAATKFPLLRKEFII
DEYQLLEAKAYGADVILLIAAILSKEEIKNLSEFAKSLKLNVLLEVHNEEELQKSIMPSL
DMLGVNNRNLKTFDVSLETSKALSALIPDDFVKVSESGISSIAAIQDLKDYGYQGFLIGE
NFMKTDTPGAHAKKFIEQLEAK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacatattagataaaatagtactagacaaacgcaaggaagtagcacttagaaaagcg
ctaattcccgtttcgcaattagagcaatctgttttatttgccagacctgaaaattctcta
gcgaccgcattacgcaatagtgcctctggcatcattgcagaacacaaaagaagatcgcct
tctaaatcagaaatcaaccaaagtttaaatgtacaagatgttgctactggctatgaagct
gcaggagtatgtggaatgtctgttttaaccgatgccaaatactttgggggctctctagat
gatcttcttattgcaagagccgctacaaaatttccattactccgtaaagaatttattatt
gatgaataccaacttttagaagcaaaagcctatggggcagatgtaattttattgattgct
gctattttatcaaaagaagaaattaaaaatctttctgaatttgcaaaaagcctaaaacta
aatgtgctattagaggttcacaacgaagaagagttacagaaatctatcatgccaagttta
gatatgttaggtgtaaataatagaaacttaaaaacttttgacgtaagtctagaaacaagt
aaagctctttctgctttaattcctgatgattttgtaaaagtttctgaaagcggaataagt
tctatcgctgctattcaagatttgaaagactatggataccaaggttttttaattggtgag
aattttatgaaaaccgatactcctggtgctcacgctaaaaaattcattgaacaattagaa
gccaaataa

DBGET integrated database retrieval system