KEGG   Cellulophaga algicola: Celal_2420Help
Entry
Celal_2420        CDS       T01404                                 

Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
cao  Cellulophaga algicola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cao00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Celal_2420
DNA repair and recombination proteins [BR:cao03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Celal_2420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2762497..2763114
Genome map
AA seq 205 aa AA seqDB search
MEFSSKLLENAVYEISQLPGIGKRTALRLALHLLKQPEEQTSHLTSALGKLRSQIKFCSN
CHNISDVALCEICANSKRDAAIICVVEDIRDVMAIENTGQFRGLYHVLGGKISPMECVGP
QDLTIVSLVEKVKKGGVSELIFALSSTMEGDTTNFYIFKQLEGVTVKTSTIARGIAVGDE
LEYADEITLGRSILNRIPFENSMKA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcgtcaaaacttttagaaaatgcagtctatgaaatttcgcaattgcctgga
attggaaaacgtacagcattgcgtttggctttgcatttgctaaaacaaccagaagagcaa
acatctcatttaacaagtgctttagggaaattaaggagtcaaattaaattttgctctaat
tgtcataatatatctgacgtagcactttgtgaaatttgtgcaaattctaagagagatgct
gctataatttgtgtggtagaagatattagagatgtaatggcgatagaaaacacaggccag
tttagggggttgtatcatgtgctgggaggtaagatctctccgatggaatgcgtaggcccg
caagatctaaccatagtttcgcttgttgaaaaagtaaaaaagggaggtgtgagtgagctt
atctttgcattaagttctactatggaaggagatacaactaacttttatatctttaagcaa
ttggaaggtgtaacagtaaaaacatcaaccattgcaagagggattgctgtaggtgatgag
cttgaatatgcagatgaaattaccttaggacgtagtattttaaaccgaattccattcgaa
aattctatgaaagcataa

DBGET integrated database retrieval system