KEGG   Cellulophaga algicola: Celal_2421Help
Entry
Celal_2421        CDS       T01404                                 

Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cao  Cellulophaga algicola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celal_2421
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celal_2421
  Amino acid metabolism
   00310 Lysine degradation
    Celal_2421
Enzymes [BR:cao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Celal_2421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2763204..2764538
Genome map
AA seq 444 aa AA seqDB search
MSKFELKLPQMGESVAEATLTTWLKEVGDTIEMDEAVFEIATDKVDSEVPSEVEGVLVEK
LFNIDDIISVGQTVAIIEIQDGSSDTVAVEDSKPVAAAAIEQEIESVKDVVSAPVADYSG
TDRFYSPLVKNIAKEEGVSVAELDQIAGTGKEGRVTKNDILEYVENGKSGKQVASAQEAS
PVTPNVASSAPVKKEVVASEVASNAKMANGDEVIPMSRMGKLIAQYMRDSISTSAHVQSF
IEVDVTNVVNWRNKNKISFEKREGEKLTFTPIFMEAVAFALKKYPMMNISLDGDTVVKKK
NINIGMAAALPDGNLIVPVIKNADQLNLVGMAKAVNDLATRSRNNKLKPDEIKEGTYTVT
NVGTFGSVFGTPIINQPQVGILALGAIRKVPSVIETPEGDFIGIRSKMFLSHSYDHRVVN
GALGGMFVKAVADFLEAWDVNREI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtttgaattaaaattaccacaaatgggagagagtgttgcagaagcaacactg
actacttggttgaaagaagtaggtgatactattgaaatggatgaagctgtttttgaaatt
gctacagataaggtagattcggaagtgcctagtgaggttgaaggtgttttggttgaaaaa
ctttttaacatcgatgatattatatcggtaggtcaaacggttgcaataatcgaaattcaa
gacggttcttcagacactgttgctgtagaggatagtaagcctgttgcagcagctgcaatt
gagcaggaaattgaaagtgtaaaagatgtggttagtgcgccagttgcagattatagtggt
acagatcgtttctattctcctttagtaaaaaatatagctaaagaagagggggtttctgtt
gcagaattagatcaaatagcgggaacaggcaaagaaggtagagttactaaaaatgacatt
cttgaatacgtagaaaatggcaaatcagggaagcaggttgcttcagctcaagaggcttcg
ccagttactcctaatgtagcatcatctgctccagttaagaaagaggttgttgctagtgaa
gttgcttcaaatgcaaaaatggcgaatggtgatgaggtaatcccgatgagtagaatgggg
aaacttattgctcagtatatgcgagatagtatttctacatcagcacatgtgcaaagtttt
atagaagtagatgttaccaatgtagttaattggagaaataagaataaaatcagctttgag
aaaagagaaggagagaagcttactttcactccaatctttatggaggctgtagcttttgct
ttaaagaaatatcctatgatgaacatttctttagatggcgatacagtcgttaagaagaaa
aatataaacataggtatggcagcagctttgccagatggtaatttaattgttcctgtaatt
aaaaatgcagaccagttaaaccttgtaggtatggcgaaagcagttaatgatttggcaact
agaagtagaaataataaactaaagccagacgaaataaaggagggtacgtatacggtaact
aatgttggtacatttgggagtgtctttggtacgccaattataaaccaaccgcaagtaggt
attcttgcgttaggagctatacgtaaagtaccttctgttatagaaactcctgaaggagat
tttataggaattagaagtaagatgtttttatctcatagttatgatcatagggttgtaaat
ggtgcgttagggggtatgtttgtgaaagcggtagcagatttcttagaggcttgggatgtt
aatagagagatttaa

DBGET integrated database retrieval system