KEGG   Cellulophaga algicola: Celal_2421Help
Entry
Celal_2421        CDS       T01404                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cao  Cellulophaga algicola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celal_2421
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celal_2421
  Amino acid metabolism
   00310 Lysine degradation
    Celal_2421
Enzymes [BR:cao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Celal_2421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2763204..2764538
Genome map
AA seq 444 aa AA seqDB search
MSKFELKLPQMGESVAEATLTTWLKEVGDTIEMDEAVFEIATDKVDSEVPSEVEGVLVEK
LFNIDDIISVGQTVAIIEIQDGSSDTVAVEDSKPVAAAAIEQEIESVKDVVSAPVADYSG
TDRFYSPLVKNIAKEEGVSVAELDQIAGTGKEGRVTKNDILEYVENGKSGKQVASAQEAS
PVTPNVASSAPVKKEVVASEVASNAKMANGDEVIPMSRMGKLIAQYMRDSISTSAHVQSF
IEVDVTNVVNWRNKNKISFEKREGEKLTFTPIFMEAVAFALKKYPMMNISLDGDTVVKKK
NINIGMAAALPDGNLIVPVIKNADQLNLVGMAKAVNDLATRSRNNKLKPDEIKEGTYTVT
NVGTFGSVFGTPIINQPQVGILALGAIRKVPSVIETPEGDFIGIRSKMFLSHSYDHRVVN
GALGGMFVKAVADFLEAWDVNREI
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtttgaattaaaattaccacaaatgggagagagtgttgcagaagcaacactg
actacttggttgaaagaagtaggtgatactattgaaatggatgaagctgtttttgaaatt
gctacagataaggtagattcggaagtgcctagtgaggttgaaggtgttttggttgaaaaa
ctttttaacatcgatgatattatatcggtaggtcaaacggttgcaataatcgaaattcaa
gacggttcttcagacactgttgctgtagaggatagtaagcctgttgcagcagctgcaatt
gagcaggaaattgaaagtgtaaaagatgtggttagtgcgccagttgcagattatagtggt
acagatcgtttctattctcctttagtaaaaaatatagctaaagaagagggggtttctgtt
gcagaattagatcaaatagcgggaacaggcaaagaaggtagagttactaaaaatgacatt
cttgaatacgtagaaaatggcaaatcagggaagcaggttgcttcagctcaagaggcttcg
ccagttactcctaatgtagcatcatctgctccagttaagaaagaggttgttgctagtgaa
gttgcttcaaatgcaaaaatggcgaatggtgatgaggtaatcccgatgagtagaatgggg
aaacttattgctcagtatatgcgagatagtatttctacatcagcacatgtgcaaagtttt
atagaagtagatgttaccaatgtagttaattggagaaataagaataaaatcagctttgag
aaaagagaaggagagaagcttactttcactccaatctttatggaggctgtagcttttgct
ttaaagaaatatcctatgatgaacatttctttagatggcgatacagtcgttaagaagaaa
aatataaacataggtatggcagcagctttgccagatggtaatttaattgttcctgtaatt
aaaaatgcagaccagttaaaccttgtaggtatggcgaaagcagttaatgatttggcaact
agaagtagaaataataaactaaagccagacgaaataaaggagggtacgtatacggtaact
aatgttggtacatttgggagtgtctttggtacgccaattataaaccaaccgcaagtaggt
attcttgcgttaggagctatacgtaaagtaccttctgttatagaaactcctgaaggagat
tttataggaattagaagtaagatgtttttatctcatagttatgatcatagggttgtaaat
ggtgcgttagggggtatgtttgtgaaagcggtagcagatttcttagaggcttgggatgtt
aatagagagatttaa

DBGET integrated database retrieval system