KEGG   Cellulophaga algicola: Celal_2500Help
Entry
Celal_2500        CDS       T01404                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
cao  Cellulophaga algicola
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cao00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cao00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cao00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2879259..2881736)
Genome map
AA seq 825 aa AA seqDB search
MKALKRTPLIILFISIFISSCQENGVEVIADQDFNKDWLFIKDTVPQGEAIHLDDSTWRK
LNVPHDWAIEGPFDSKNNARNGGLPIDGIAWYRKHFTIDAKNKNKQVAIEFDGVMDNSKI
YVNGNFVGERHYGYSGFEFDITPFIKFGEDNIIAVQLAPEVLSERWYPGAGIYRNVRLKL
NEKVHIPQWGTFISTPEVTSEKATVTIKTKLKNATDKPQEIFLETTIVDASNKTMGIATE
TIDVANNSEEQLTQHMTVVNPSLWDVGKPNLYKAISRVKIKDQIVDEFETEFGIRTIEFK
KEGFFLNGKAVELNGVCMHHDLGPLGAAVNYRATERQMQIMQNMGANALRTSHNPPSPEM
LQVCDRLGIVVIDEAFDEWKEPKVPNGYSNYFDQWAEKDLRDMIKRDRNHPSVIMWSIGN
EILEQGKKDGWKIAKMLNDICHDEDDSRPTTAGFNYYPASFVNQLAAQIDVVGVNYKPAY
YGEIREQNPDMIFYGSETSSQTSTRGFYEVPQDYHVNKETNQVSSYDVTVGPPWAYAPDI
EFDAQEKNPHSLGEFIWTGFDYLGEPTPYGGRDNSTNGYWNDDWPSHASYFAPVDLVGFP
KDRFYLYQSQWTSAPMVHVLPHWNWEGKEGQTIPVYAYTNADEVELFVNGTSFGKKVKGK
DLTDVFTEYNGFKKGIYKSKYRLSWQVAYQPGSLKVVAYTNGKQVASKEIKTAGKPAKIS
LVADRNTIKADGKDLSFVSVSIEDKDGNLCPNAANLINFKVEGAGVLEAVGNGNSASLES
FQENYIKSFFGKSLAIIKGTENTGEVTITATGENLATASLIIKTE
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttaaaacgtaccccattgatcattttgttcatttccatttttatatcttcc
tgccaagagaacggcgtagaagttatagccgatcaagattttaataaagattggcttttt
attaaagatactgttcctcaaggtgaagccatacatttagatgatagtacgtggcgaaaa
ctaaatgtacctcacgactgggccattgaaggtccttttgattctaaaaataatgccaga
aatggcgggttgcctattgatggaattgcatggtacagaaaacactttaccattgacgct
aaaaataagaacaaacaagttgctattgaatttgatggggtcatggataattccaaaata
tatgtaaacggaaattttgttggagaacgtcattacgggtatagtggttttgagtttgac
atcactccgtttataaaatttggtgaagacaatattatcgcagtacaacttgctcctgaa
gttttatcagaaagatggtatcccggagccggtatttatcgcaacgtacgcttaaaatta
aatgagaaagtacatatcccgcaatggggtacatttatttcaactccagaagttacatca
gaaaaagcaacggtaacgattaaaacaaagttgaaaaatgctactgataaacctcaagag
atatttttagaaactacgattgttgatgcttccaataaaactatgggtatagctacggag
accatagatgtagcaaataattcagaggagcaattaacacaacatatgacggttgtaaat
ccaagtctttgggatgttggcaagcctaatttatataaagcaataagccgtgtaaaaata
aaagatcaaattgtagatgaatttgaaacggaatttggaattagaacgattgaatttaaa
aaagaaggtttctttttaaatggaaaagcggtagaacttaatggcgtttgtatgcatcac
gatttaggccccttaggtgctgccgtaaattacagagcaacagagcgtcaaatgcaaatt
atgcaaaatatgggtgccaatgcgctacgtacaagtcataatccaccatcaccagaaatg
ctacaagtatgtgatagattaggcattgtggttattgatgaagcttttgatgaatggaaa
gaaccaaaagttcctaatggctacagcaactattttgaccaatgggcagaaaaagatttg
cgagacatgattaagagagatcgcaatcatccctctgtaattatgtggagtattggtaat
gagattttagagcaaggtaaaaaagacggttggaaaattgccaaaatgttgaatgatatt
tgccatgatgaagatgattctagacccacaactgccggcttcaattattatcctgcttct
tttgtaaatcaattagccgctcaaatagatgttgttggggttaattacaaacctgcatat
tatggagaaatcagggaacaaaacccagatatgattttttacggatcagaaacttcatca
caaacaagtacaagaggtttttatgaagttcctcaagactaccatgtcaacaaagaaacc
aaccaagtttctagttatgatgttactgttggtccgccttgggcctatgctccagatatt
gaatttgatgcgcaagaaaaaaacccacattctttaggagaatttatatggacaggcttt
gattatttaggagaaccaaccccttatggtggtagagataattccacgaatggctattgg
aatgatgattggccttctcacgcctcttattttgctcctgtagatttagtaggcttccct
aaagaccgcttttatttataccaaagtcaatggacatcggctcctatggttcatgtttta
ccacattggaattgggaaggcaaagaaggacaaacaatcccagtttacgcttataccaat
gcagatgaagtggagttattcgtaaacggcacctcttttggaaaaaaagtaaaaggcaaa
gatctaacagacgtttttactgaatataatggctttaagaaaggtatctacaaatctaaa
tacagactatcatggcaggtggcttaccaaccaggcagcttaaaagtggttgcgtatacg
aatggaaagcaagtagcttctaaagaaataaaaacggcaggaaagcctgctaaaatttcg
ttagtagccgatagaaatacaattaaggcagatggtaaagacctttctttcgtctccgta
agcatagaagacaaagacggcaatttatgccctaatgcagctaatttgattaattttaaa
gtggaaggagcaggagtattagaagcggttggaaatggaaattctgcctcgctagaatct
tttcaggaaaactacatcaagtcattttttggtaaaagtttagcgattatcaaaggtact
gaaaacaccggagaagttactattacggcaaccggagaaaatttagctacagcaagctta
atcattaaaacagaatag

DBGET integrated database retrieval system