KEGG   Cellulophaga algicola: Celal_2753Help
Entry
Celal_2753        CDS       T01404                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cao  Cellulophaga algicola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cao00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3175058..3176158)
Genome map
AA seq 366 aa AA seqDB search
MMMRIPLFKTVFLSLFFIVSCSSDAEPEIIDPVDTEETSDATDEEPATPEPENTPEPETD
TATATNVVEAYGQLSVSGNKIVDKNNNPIQLRGMSLFWSQWMGQYYTTGTVDWLQTDWNA
TVVRAAMGVEDADGYISNPATEKAKVFAVIDAAINAGIYVIVDWHSHHAEDHIPEAKAFF
AEVAQKYGDQPNIIYETYNEPLDVSWTGVLKPYHETIIAEIRKYDPDNLVICGTRTWSQR
VDEVVGNKINDANVAYTLHYYASTHKEELREIAQIALNNDIAIFVTEYGVTEASGNGYID
EASTNTWWSYLDENKISWCNWSIADKNESAAALTPGASGSGNWAESELTVSGKLVRSEML
EKNPTY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgagaattccccttttcaaaacagtatttttaagcctattttttatagtctcc
tgtagcagcgatgcagagcctgaaattattgaccctgtagacaccgaagaaacttcagat
gctacggatgaagaacccgctactcccgaaccagaaaacacccctgaacctgaaactgat
acagcaacagctaccaatgttgtggaagcttatggacagctgagtgtttcaggaaacaaa
attgtagataagaacaacaatcctattcaactacgaggtatgtctttattttggagccaa
tggatgggacaatactacaccacaggaacggtggactggctgcaaacagattggaatgct
accgtagttagagctgctatgggtgttgaggatgcagatggctacatcagcaaccctgct
actgaaaaagccaaagtatttgctgtaatagatgctgctataaatgctggtatctatgta
attgtagattggcatagccaccatgcagaagatcatatccctgaggctaaagctttcttt
gcagaagttgctcagaaatacggagaccaaccaaatattatctatgaaacgtataatgag
cctttagatgtttcatggactggagttttaaaaccgtaccacgaaacgatcatcgcagag
atacgaaagtatgatccagacaatcttgttatttgtggtactagaacttggtctcaacgt
gtagatgaagtggtaggtaataagattaatgacgcaaatgtagcgtacaccttacattac
tatgcttctacccataaagaagaattaagagagatagcgcaaatagctttaaacaatgat
atcgccatttttgttacggagtatggtgttacagaagcttctggaaatgggtatattgat
gaagcgtctaccaatacgtggtggagctatttagacgaaaataaaatttcttggtgtaat
tggtctattgcagataaaaatgagagtgccgctgcattaacaccaggagctagtggctca
ggaaattgggctgaaagtgagcttactgtttctggaaagttagtccgttcagaaatgtta
gaaaaaaatcctacctactaa

DBGET integrated database retrieval system