KEGG   Cellulophaga algicola: Celal_2757Help
Entry
Celal_2757        CDS       T01404                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cao  Cellulophaga algicola
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cao00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cao00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cao02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3179043..3180086
Genome map
AA seq 347 aa AA seqDB search
MKRLQNIFYAVFILFGFSPGKAQTDTTAIATTKMADFTIAFGSCNKNSIPNLLWDDILNT
HPDVWIWGGDNVYADTDNMQKLQEFYEAQENVEGYKKLKEKVPVIGTWDDHDYGLNDGGV
EYKSKKESQQVFLDFFKVPKGSPRRAQEGVYAVHNYETPKGTVKVVVLDTRYFRTALTKD
TVTKKRTKPNTYGEGTVLGTTQWEWLANELNTSTADFNILVSSIQVLSNEHGFETWGNFP
HEVDKLQKLIADSKAKGVVVLSGDRHISEFSKTPIEGVAYPLIDFTSSGLTHVYSSYSGE
ANPYRVGAVVSEVSFGTLSFNFETSHIIFKMIGDEGKVLGILEQGFK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaagagattacaaaacatattttatgctgtgtttattttattcggattttccccaggg
aaggctcagacagacacaacggctatagctacaactaagatggcagattttacgattgct
tttggttcttgtaataaaaattctatccctaatttattgtgggatgatattttaaatacc
catcccgatgtatggatttggggaggtgataatgtgtatgcagatacggataacatgcag
aagcttcaggaattttacgaagcgcaagaaaatgttgaaggatataaaaaattaaaggaa
aaagttcctgtgattggtacttgggatgatcatgattacggtttaaatgatggtggagta
gagtataaatcgaagaaagaaagtcagcaagtattcctagatttttttaaagtacctaaa
gggagtccacgtagagcccaagaaggcgtgtatgctgtgcataattatgagacgcctaaa
ggaactgtaaaagtagtggtgctagatacacgttattttagaacggcgcttactaaagat
acggtaactaagaaaagaacaaaaccgaatacctatggggaaggtactgttttaggaaca
acacaatgggagtggttagcgaatgaactgaataccagtacggcagattttaatatttta
gtgagtagcatacaggtattatctaatgagcatggttttgaaacatggggtaattttccg
catgaagtagataaattacaaaaattgattgctgattctaaagcaaaaggcgttgtggtg
ctctctggagaccggcatatttctgaattttcaaaaacgcctattgagggggtagcatat
cctttgatagattttacgagtagcggacttacccatgtgtattcttcctattcaggagaa
gccaatccatatagggtaggagcggtggtttctgaggtaagttttggtactttgagtttt
aattttgaaaccagtcatattattttcaaaatgataggcgatgaaggtaaagtcttgggt
atcttggaacaagggtttaaataa

DBGET integrated database retrieval system