KEGG   Cellulophaga algicola: Celal_2874Help
Entry
Celal_2874        CDS       T01404                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cao  Cellulophaga algicola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Celal_2874
Enzymes [BR:cao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Celal_2874
Exosome [BR:cao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Celal_2874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3313899..3315794
Genome map
AA seq 631 aa AA seqDB search
MPNVEVHSLFTEFDINLFKAGKHFQLYEKLGSHLITLNGIKGTYFSVWAPTANSVSVIGD
FNSWQVGEHELNVRWDDSGIWEGFIPEIEKGALYKYSIRSNNQGIRTEKADPFARYCEKP
PKTGSVVWDGDYSWQDKAWMGYRKDKNGLDKPYSVYEVHLGSWKRKEDNQFLSYLELAEE
LVQYVKEMNFTHVEFMPIMEYPYDPSWGYQLTGFFAPTSRFGNPEEFKVLVDKLHQNDIG
VILDWVPSHFPEDAHGLGFFDGSHLYEHPDRRKGYHPDWKSLIFNYGRNEVRAFLISNAM
FWMDQFHVDALRVDAVASMIYLDYSREEGEWEPNIYGNNENLEAISFLKEMNQQLYASFD
GIQTIAEESTAFSGVSRPVDLGGLGFGMKWMMGWMHDTLEYFKKEAIYRKHHQNDITFSM
TYAFSENFMLPFSHDEVVYGKQSLLNRMPGDEWQRFANLRLLFGYMFTHPGAKLIFMGGE
FGQSSEWDFQKSLDWHLTQYNFHSGIQETVKDLNTIYKNYPALYEKQFSTEGFQWIDYGD
GENSVLAYIRKGHDAKNDLLVICNFTPVQRDNYRLGVPKATKLKEIFNSDAEKYGGSGVL
NAKIKTEKIASHTYKNSIEITLPPLGIVILQ
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacgtagaagtacatagcctatttacagaatttgatataaatctatttaaagcg
ggtaaacattttcagttgtatgaaaaattagggtcacaccttattactttaaatggaatt
aaaggcacctatttttcagtgtgggctcccacagcaaattccgttagtgttattggcgat
tttaattcatggcaagtaggagagcatgagcttaacgtacgttgggatgatagtggtatt
tgggaaggttttattccagaaatagaaaaaggcgctctttataagtatagtatcaggtct
aataaccaaggtattagaacagagaaagcagatccttttgcgcgctattgcgaaaaacca
cccaaaactggttctgttgtttgggatggtgattattcgtggcaagacaaggcgtggatg
ggttaccgtaaagataaaaatggtttagataaaccgtattccgtgtatgaagtgcatttg
gggtcttggaaacgaaaagaagataatcagtttttgagttatttagaattggcagaggag
ttagtgcagtatgtaaaagaaatgaattttacacatgtagaatttatgccgattatggaa
tacccgtatgacccttcttgggggtaccaattaacaggcttttttgcaccaacgtctaga
tttggaaacccagaagagtttaaagttttggtagataaattacatcagaatgatattggg
gttatattagattgggttccatcacattttcctgaagatgcgcatggactaggatttttt
gatggctcacatttatatgagcacccggatagacgtaaaggatatcatcctgattggaaa
agtttaattttcaattatggtagaaatgaggttcgtgcatttctaattagcaatgctatg
ttctggatggatcagtttcatgtagatgccctacgggtagatgctgttgcttcaatgatt
tacctagattattctagggaagaaggcgagtgggagccaaatatttatggaaataatgaa
aatttagaggcaatttcatttttaaaagaaatgaatcagcaattatatgcaagttttgac
ggtatacagaccatagcggaagaatctactgctttttcaggggtgtcacgacctgtagat
ttaggtggtttaggctttgggatgaaatggatgatgggttggatgcatgatactttagag
tattttaaaaaagaagctatctatagaaaacaccatcagaatgatattacgtttagtatg
acgtatgccttctctgagaattttatgcttcctttttcgcatgatgaagtggtgtatggg
aaacaatcgcttttaaatagaatgccaggagatgagtggcagcgttttgctaatttgcgt
ttgctatttgggtacatgtttacacacccaggagcaaagctaatttttatgggaggagag
tttggacaatcttctgaatgggatttccagaaaagtttagattggcatttgacgcaatat
aattttcattcaggaatacaagaaactgtaaaagatttaaataccatttataaaaactat
ccggcattgtatgaaaagcaatttagtacagaaggtttccaatggatagattatggtgat
ggtgaaaattctgtactggcatacatccgaaaaggacatgatgctaaaaacgatttactt
gtaatctgtaatttcactccagtacaaagagataactatagattaggggttccaaaagca
actaaactaaaagaaatttttaatagtgatgctgaaaaatatggaggctcaggagtgtta
aatgcgaagatcaaaacagaaaaaatagcgagtcatacatataagaattccatagaaata
acattgcctccgctcggaattgttattttacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system