KEGG   Cellulophaga algicola: Celal_2887Help
Entry
Celal_2887        CDS       T01404                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cao  Cellulophaga algicola
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Celal_2887
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Celal_2887
Enzymes [BR:cao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Celal_2887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3330365..3331291
Genome map
AA seq 308 aa AA seqDB search
MSELSVDHLLGIKYLKEQDIQLIFETADHFKEVINRSIKKVPSLRDITIANVFFENSTRT
KLSFELAEKRLSADVINFSAGQSSVKKGETLIDTVNNILAMKVDMVVMRHPNPGAGIFLS
KHVKAAIVNAGDGAHEHPTQALLDSYSIREKLGDVAGKNVVIVGDILHSRVALSNIFALK
LQGANVKVCGPKTLIPKHITSLGVEVETNLKKALEWCDVANMLRIQNERLDISYFPTTRE
YTQQFGVHKKLLDSLDKEIVIMHPGPINRGVEITSEVADSNQSIILNQVENGVAIRMAVI
YLLASKIK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagttgagtgtagatcacttattaggaattaaatatcttaaagagcaagatatt
cagcttatttttgaaactgcagatcattttaaagaggtcatcaatagatctattaaaaaa
gtaccttctttacgagatattacaattgctaatgttttttttgaaaatagtacccgaaca
aaactttcttttgaacttgcagaaaaacgtttgtctgcagatgtaattaatttttcagca
ggacaatcttcagtcaaaaaaggagaaaccctaatagataccgtgaacaatattctagct
atgaaggtagatatggtggttatgcgtcatcctaatcccggagcaggaatatttttatct
aaacatgtaaaggcagctattgtaaatgcaggtgatggtgctcatgagcaccccacgcag
gcattgttagattcttattctatacgagaaaaattgggtgatgttgcaggtaaaaatgta
gttatagtaggtgatattttacactccagggtagcattatctaatatctttgcactaaag
ttacaaggtgctaatgtaaaagtttgcggccctaaaacattaattcctaaacatataacg
tcattaggtgtagaggtagaaacaaaccttaagaaagcattagaatggtgtgatgtagct
aatatgttgcgcatacaaaatgaacgtttagatattagttatttcccaaccacgagagag
tacacgcaacaatttggagtacataaaaagttgttggatagtctagacaaagagattgta
ataatgcatccaggacctataaaccgcggggtagaaattacaagtgaagtagcagattct
aaccagtctataatattaaaccaagtagaaaatggtgtagctattcgtatggcagtgatt
tatttattagcttcaaaaataaaatag

DBGET integrated database retrieval system