KEGG   Cellulophaga algicola: Celal_2917Help
Entry
Celal_2917        CDS       T01404                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cao  Cellulophaga algicola
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Celal_2917
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celal_2917
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Celal_2917
Enzymes [BR:cao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Celal_2917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3358099..3359391)
Genome map
AA seq 430 aa AA seqDB search
MNFYSLNKKAPNVSFKDAVIKGIAPDRGLYFPEKITPLPNDFFENIANLSPIEIAQKAIK
QFVSDDIDDDKLKTILEDVLNFDFPVVEINKNIGTLELFHGPTLAFKDVGAGFMARCLGY
FSEGSNTEVTVLVATSGDTGGAVANGFLGVAGVKVVILYPTGKVSDIQEKQLTTLGQNIT
ALEVEGTFDDCQTMVKTAFLDEDITSVKQLTSANSINVARWLPQLFYFLFAYKQAKSQGK
EIVFSIPSGNFGNICAGIVAQQLGMPVKHFIASTNVNDVVPRFMNTKSYDPKPSIATISN
AMDVGDPSNFIRIRHIYNDDFDTIAKNISSYAFTDEQTKEAMLELYNDYNYVADPHGAVG
YLGLKKYQETNPDTYGIFLETAHPVKFLDIVEDTIKENLDIPKKIIKQMNKKKKSIKIST
YDELKKFLID
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttacagcctcaacaaaaaagccccaaacgtaagttttaaagacgcagtaatt
aaaggaattgctccagatcgtggcttatattttccagaaaaaataacgccactacctaat
gattttttcgaaaatatagcaaatttatcacctattgaaatcgcgcaaaaagccataaaa
caatttgtctctgatgatattgatgatgataaactaaaaactatactagaagacgtttta
aattttgattttcctgtagtagaaatcaataaaaatattggaaccttggagttattccat
ggtcctactttggcatttaaagatgttggcgcaggttttatggcaagatgtctagggtat
ttttcagaaggaagtaacaccgaagtaaccgtacttgtggcaacttctggagatactggt
ggtgcagttgctaatggtttcttaggtgtagcaggcgtaaaagtagtaatcttataccct
acagggaaagtgagtgatattcaagaaaaacaactaactactttaggccagaatattacg
gctttagaagtagaaggtacttttgatgattgccaaacgatggtaaaaacggcatttcta
gatgaagatattacttctgtaaaacaattaacatcggcaaattctattaatgtagcccgt
tggttgcctcagcttttctatttcttatttgcttacaaacaagccaaatcgcagggtaag
gaaattgtattttctattcctagtggtaattttggtaatatttgcgcaggtattgtagca
caacaattagggatgcctgtgaagcattttatagcatctaccaatgtaaatgatgtagtc
cctagatttatgaatacgaagagttatgacccaaaaccttcaatagcgactatttcaaat
gctatggatgtaggtgatcctagtaatttcattagaataaggcacatctataatgatgat
tttgataccattgctaaaaatatatcttcttatgcatttactgatgaacaaactaaagaa
gccatgttggaattgtacaatgactacaattacgttgcagatccgcatggcgctgttggg
tatttaggccttaaaaaatatcaagaaacgaatcctgacacctacggcattttcttagaa
acagcgcatcctgttaagtttttagatattgtagaagataccataaaagagaatctagat
atccctaaaaagattatcaaacagatgaataaaaagaaaaaatctattaagatttcaacc
tatgatgagctgaaaaaatttctgatagattaa

DBGET integrated database retrieval system