KEGG   Cellulophaga algicola: Celal_2959Help
Entry
Celal_2959        CDS       T01404                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cao  Cellulophaga algicola
Pathway
cao00010  Glycolysis / Gluconeogenesis
cao00052  Galactose metabolism
cao00500  Starch and sucrose metabolism
cao00520  Amino sugar and nucleotide sugar metabolism
cao00521  Streptomycin biosynthesis
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
cao01120  Microbial metabolism in diverse environments
cao01130  Biosynthesis of antibiotics
cao01200  Carbon metabolism
Module
cao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celal_2959
   00052 Galactose metabolism
    Celal_2959
   00500 Starch and sucrose metabolism
    Celal_2959
   00520 Amino sugar and nucleotide sugar metabolism
    Celal_2959
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Celal_2959
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Celal_2959
Enzymes [BR:cao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Celal_2959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADV50235
JGI: Celal_2959
UniProt: E6XEE5
Position
complement(3409204..3410271)
Genome map
AA seq 355 aa AA seqDB search
MTEKNASPLLTEPLIPLAVEFKKKQGHKNGTVLAGDIGGTKTNLALFEYKDGHLTLIKQN
SYKTKNHTSLLEIIADFKVEKITKIDSICFGVAGPITKGKVHGTNFPWDIDTEELIKKLQ
LKSIFLINDMQANAYGLATLKEKDLDRLKYGSEIAGNAVIISPGTGLGEAGLFWDGTAYH
PFASEGGHCDFGPRNDFDLEIWKYFQQKYGHVSWERLLSGQGIRDTYQLIRNVSGEKETD
TFKAKMAKEDPAAVITQTALEGLDIVCRETLDLFVRFLAIETAQLALKFKATGGIYIGGG
IMPKIIKGMNREIFTDNFMQSGRMNSLLQMVPVNVILNDNTALLGAAYYAAMTLE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaatgcttcccccttacttacggaaccgttaattcctttggctgtagag
ttcaaaaaaaaacaaggtcataaaaacggtactgtattagcaggtgatataggaggaact
aaaactaatcttgcgctttttgaatataaggatggacatcttaccttaattaaacaaaac
tcctataaaacaaaaaaccatacctccttactagaaattatagcagattttaaggttgaa
aaaataaccaagatagatagtatctgttttggtgttgctggtcccataaccaaaggtaaa
gtgcatggcactaattttccttgggatattgataccgaagaactcattaagaaacttcag
ttaaaatctatttttttaataaatgatatgcaagctaatgcctatgggctagctacactt
aaagaaaaggatttagaccgcttaaaatacggttcagaaatagcaggcaatgctgttata
atttctccaggcactggtttaggagaagctggtttattttgggatggaacagcataccac
ccttttgcctctgaaggtggtcattgtgattttggtccgagaaatgattttgaccttgaa
atatggaaatatttccaacaaaaatatggacatgtaagttgggaacgtttattatcagga
caaggcatacgggatacctaccaactgatacgcaatgtaagtggcgaaaaggaaactgac
acctttaaagccaaaatggccaaagaagatccagcagctgttattacacaaacagcctta
gaaggattagatatagtttgcagagaaaccctagatctttttgttcggtttttggctata
gaaacggctcaacttgctttaaaatttaaagctactggtggtatttatattggcggagga
attatgcctaagattattaaaggaatgaatcgtgaaatatttacggataattttatgcaa
tctggacgaatgaattcattattacaaatggttcccgtaaatgttattctaaatgataac
actgctttactcggagcagcttattatgctgcaatgacacttgaataa

DBGET integrated database retrieval system