KEGG   Cellulophaga algicola: Celal_2962Help
Entry
Celal_2962        CDS       T01404                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cao  Cellulophaga algicola
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celal_2962
   01230 Biosynthesis of amino acids
    Celal_2962
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celal_2962
  Energy metabolism
   00680 Methane metabolism
    Celal_2962
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Celal_2962
Enzymes [BR:cao01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Celal_2962
Exosome [BR:cao04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Celal_2962
  Exosomal proteins of melanoma cells
   Celal_2962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3412327..3413016)
Genome map
AA seq 229 aa AA seqDB search
MGKLILVRHGKSLWNVKNVFTGWTDIDLATEGINEAETAGQLIKSNLIDIDICFSSYLKR
AIRTAWILLETAEMMHVDCRYSWKLNERHYGDWQGKNKDEVLEEVGEEFFLSVRRGYETP
PPSLSIYDKRNPEFDANYKALDPSILPLAESLKDTSKRVVNYFFEAIAPELAKGKNVLIS
AHGNSLRALIEFLEHISSDEIANVEVATGVPHLYEFDEKLNVIDHYQLK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaattgatattggttaggcatggcaaaagcttatggaacgtaaaaaacgtattt
acgggatggacggacattgacttggctacagaaggaattaatgaagcagagacagctggg
caacttatcaaatcaaatctcatagatattgatatttgcttttcctcctatctaaaaaga
gctattagaacagcgtggattttattggaaacggcagaaatgatgcacgtagactgccgc
tatagctggaagctgaatgaaagacattatggtgattggcaaggaaaaaataaagatgaa
gttctagaagaagtaggcgaagaattctttttgagcgttagaagaggttatgaaacccct
cctcctagcctttcaatttatgataaaagaaaccccgaatttgatgcgaactacaaggct
ttagatccatcaattttacctctggctgaatcactgaaagatacttcaaaaagagtggta
aattatttttttgaagctattgctcctgagcttgccaaaggaaaaaacgtattgatctct
gcgcatggcaattcattacgcgcactcatagaattcttagagcatatctcatctgacgaa
atagctaacgtagaagtagctactggggttcctcatttgtatgaatttgatgaaaaatta
aacgtaatagaccattatcaattaaaataa

DBGET integrated database retrieval system