KEGG   Cellulophaga algicola: Celal_3034Help
Entry
Celal_3034        CDS       T01404                                 

Definition
1-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cao  Cellulophaga algicola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celal_3034
   01230 Biosynthesis of amino acids
    Celal_3034
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celal_3034
   00030 Pentose phosphate pathway
    Celal_3034
   00051 Fructose and mannose metabolism
    Celal_3034
   00052 Galactose metabolism
    Celal_3034
  Energy metabolism
   00680 Methane metabolism
    Celal_3034
Enzymes [BR:cao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Celal_3034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3479235..3480188)
Genome map
AA seq 317 aa AA seqDB search
MTPKIITLTVNPAIDKSTTVNGIKPNSKLRCEQPIFEAGGGGINVSKVLQKLGQDSLCMY
LAGGYTGAYFKTLLSETGIQQECISIKGITRENLAVTDVNCHQQYRFGMPGPEISEEECE
ETIKRLDKLLTEGTFLVASGSLSLGMPLDFYARIAKLVLAKKAKLILDTSGEPLIIGAQA
GAFLIKPNLGELSRLCGVAEISFADLKPLAQKFIKNNPCELMVVSLGAQGALVITEDYHE
HINAPVVYQNSTIGAGDSMVAGMVYALANNKPISEIAKFGVACGTAATMTPGSQLCTIED
VNKLYKFIKDQPTKVYS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgaagataattaccttaactgttaaccctgctattgataaaagcactactgta
aacggaataaagccaaatagtaaattgcgttgtgaacaacctatttttgaagccggaggt
ggtggaataaatgtgtctaaagttttacaaaaattaggacaagattcactttgcatgtac
ctcgccggtgggtatactggggcttattttaaaacgttactatcagaaactggtatacaa
caagagtgtatttcgattaaaggaataacgagagaaaatttagcggtgaccgatgtaaat
tgccatcagcaatatagatttgggatgcctggtcctgaaatatcagaagaagaatgtgag
gaaacaattaaacggctagataagctgctcacggaaggaacatttttagttgctagtggt
agcctttctctgggaatgcctttagatttttatgcccgtattgccaagttggtgctagct
aagaaagcaaaactaattttagatacttctggagaaccattaatcataggtgctcaagcc
ggtgctttcctgattaaacccaatctaggagaattaagtaggttatgtggagtagctgaa
atttcatttgctgacttgaaaccacttgctcaaaaatttataaaaaataatccatgtgaa
ctaatggtagtctcgttaggtgctcaaggagcattagtgattactgaagattatcacgaa
catataaatgcaccagtagtatatcaaaacagtactattggtgctggtgacagtatggtt
gcaggtatggtttatgccttagcaaataataaaccgatcagtgaaattgctaaatttggt
gttgcttgtggtaccgctgcgacgatgactcctggttcacaattgtgtactattgaagat
gttaataagctttataaatttataaaggatcaaccaacaaaagtctattcttaa

DBGET integrated database retrieval system