KEGG   Cellulophaga algicola: Celal_3121Help
Entry
Celal_3121        CDS       T01404                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
cao  Cellulophaga algicola
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Celal_3121
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Celal_3121
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Celal_3121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3581916..3583274
Genome map
AA seq 452 aa AA seqDB search
MKKILILGVFFLVIIHSSTAQSIRKNYTEMTDYEKSELVDSFYAIRAGNNWFDDIATFHM
NFFNFDNTTDTSRLDLHFNLPDESEKEIFLAWHRRAVFELERYVQDYNPKLSIPFWESPL
DQSTTSALWDETFIGSFNTNWNLNRNLGGNGPMPTPANLATVYGLSDFFLFTNELERRPV
HRGSHVWTGGAMPTPLSPRDPVFFLHHTYIDYVWHNWEEVHHNSAFIRTDMIRFDGTYSF
NGETLPVVNPNDIIDTRALGVFYATNGLATLDNYIVSNTYRPLESFYYQYTVEAGDNFIV
PTGANCIIESVNEIVLKPGFEAHSGSDFTASIDVQNANTGKKSTANRSYKPYDVVPNLQV
IVWEEDDKDDTPIIIQAYPNPFTETININLNKKIDCKVEVFNMMGMLIRDESFQNTDKVI
IKDLYGLASGFYVIRIVDGGGNIVLAKRVVKL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatattaattttaggtgtcttttttctagttataattcattctagtactgca
cagagtattcgaaaaaattatacagagatgaccgattatgaaaaatcggaattagttgat
tccttctatgccataagagcgggaaataattggtttgatgacattgctacctttcatatg
aatttttttaatttcgataatacaacagatacatcaaggttagatttgcattttaattta
cctgatgaatctgaaaaagagatttttctagcatggcatagaagagcggtatttgaatta
gaacgctatgtacaagattacaatccaaaattaagtattcctttttgggagtctccgcta
gatcaatctacaacttctgccttatgggatgaaacgtttataggaagttttaataccaat
tggaatttaaatagaaacttaggaggtaacggtcctatgcctactcctgcaaacctcgct
actgtatatggactatcagacttttttctgtttacaaatgaattagaaagaaggccagta
catagaggttctcatgtttggacaggcggtgcgatgccaactccattgtctccaagagat
cctgtattttttctgcaccatacctatatagattatgtatggcataattgggaagaagta
catcataattcagcattcattagaacagatatgattcgctttgatggtacctatagtttt
aatggtgaaacattacccgttgttaatccaaatgatattatcgataccagagctttgggg
gttttttatgcaacaaatggcttagctactttagataactatattgtaagtaacacctat
agacctttagaatctttttattaccaatatacggttgaagcaggagataattttattgta
cccacaggcgctaattgtattattgaatctgttaatgaaattgtattaaaacctggtttt
gaagcgcatagcggatcagattttaccgcttcaattgatgttcagaatgcaaatacaggt
aaaaagagtacagccaacagatcttataaaccttatgatgtagttcctaatttacaggtt
attgtgtgggaagaggatgataaggatgatacgcctattataattcaagcttatcctaac
ccatttacggaaactattaatatcaatctaaataaaaagatagattgtaaggtggaagtt
tttaatatgatgggaatgttaatccgtgatgaatcttttcaaaacacggataaagtaatc
ataaaagatttatacggccttgcttctggcttttatgtaattagaatagttgatggtggg
ggaaatatcgttttagcaaaaagggtcgttaaattataa

DBGET integrated database retrieval system