KEGG   Cellulophaga algicola: Celal_3154Help
Entry
Celal_3154        CDS       T01404                                 

Definition
nitrous oxide reductase apoprotein (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
cao  Cellulophaga algicola
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Celal_3154
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Celal_3154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3620944..3622947
Genome map
AA seq 667 aa AA seqDB search
MHLRLNKITTNTLQMKKYSFYLVTLLGSVLFLSGCGDQNGNASSNGALASNNAEKVYVAP
GEHDEFYAFMSGGYSGNVTVYGLPSGRMFKEIPVFSQFPTNGYGYSEETKPMLETSFGFI
PNDDSHHPDISQTNGELDGRWLFINGNNTPRIARIDLKTFETAEIIEVPNSAGNHSSSYI
TENSEYVVAGTRFSVPIPQRDMPIKDYKGNFKGALSFISIEPETGHMDIKFQLIMPGFNY
DLSHPGRGKSHGWFFFTTYNTEEANSLLEVNASQNDKDFIAAVNWKKIEEYVANGGGTMV
PANYTHNVYSDETHSATSTMKKEVLTVDPTKVPGAVFFMPTPKSPHGVDVNPTGDYIVGN
GKLSADLTVFSFDKMIAAIDAKKYDGEAYGLPILKFEDVLAGQVKSGGLGPLHTEFDDKG
NAYTTFFISSEVVKWKVGTWEVIDRKPTFYSVGHCMIPGGNSRKPFGKYLISLNKITKDR
YLPTGPELEHSAQLYDISGDKMELIYDFPTHGEPHYAAAIPASILAPKSQKIYKLAENEH
PFATKNVSDARVEREGNVVHVYMAMIRSHFTPDNIEGIKVGDTVYFHITNHEQDFDVPHG
FMMIGANNSGLLIMPGQTKTTVWEPKQEGVWPFYCTDFCSALHQEMQGYIRVSPASSNLD
LSWSLGE
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgcacttacgcttaaataaaataaccacaaatacactacaaatgaaaaagtattcattt
tacctagtaaccctattggggtcggtcctgtttctttcaggttgcggcgatcaaaacggt
aatgcatcatcaaatggtgcgcttgcttctaataatgcagagaaagtatatgtagctcct
ggcgaacatgatgaattttatgcctttatgtctggtggatatagcggtaatgtaaccgtt
tatggtcttccttctggacgtatgttcaaagagattcctgttttttctcagtttccgacc
aatggttatggctattctgaagaaacaaaacctatgttagagacttcttttggctttatc
ccgaatgacgattctcaccacccggatatttctcagaccaatggagaattagatggcaga
tggttatttataaatggaaataatacgccacgtatagcgcgtatcgatttaaaaacattt
gaaactgctgagattattgaagtaccaaatagtgccggtaaccatagttcttcatatatc
actgaaaattctgagtacgtggtggcaggaactcgtttttcagtacctatacctcaaaga
gacatgccaataaaagattataaaggaaactttaaaggtgccttgtcttttattagtatt
gagcctgaaacgggtcatatggatattaaattccaattgattatgcctggctttaattat
gatctttcacatccaggacgtggtaaatctcacggctggtttttctttacaacctataat
acagaggaagctaattcgctgttagaggttaacgcttctcaaaacgataaagattttatc
gcagcggtaaactggaagaagattgaagaatatgttgcaaatggtggaggtactatggtg
cctgctaattatactcataatgtgtatagtgatgaaacacatagcgctacttcaacgatg
aaaaaagaagtgcttactgtagatcctacaaaagtacctggggctgtattctttatgcca
acaccaaaatctccgcacggggtagatgtaaatccaacaggagattacattgtaggtaat
ggaaagctttctgcagatcttaccgttttctcatttgataaaatgatagcagcgattgat
gctaaaaagtatgatggtgaagcttatggtcttcctattttgaaatttgaggatgtcttg
gctggtcaggttaaaagtggaggattaggtccattgcataccgaatttgatgataaaggt
aatgcgtatactacattcttcatttcttcagaagtggtaaaatggaaagtaggcacctgg
gaggttattgatagaaagccaactttttactcggttggtcactgtatgattcctggagga
aactctagaaaaccttttggtaaatacctaatatccttgaacaaaattaccaaagataga
tacctgccaactggtcccgagttagaacactctgcacagttgtatgatatctctggagat
aaaatggagcttatttatgattttccaacacatggtgagccacattacgcagcagctatt
cctgcttcaatattagcccctaaatcacagaagatttacaagcttgcagaaaacgaacat
ccatttgctaccaaaaatgtttcagatgcgcgtgttgaaagagaaggtaatgttgtacat
gtgtatatggcaatgattcgtagtcactttactcccgataatattgaaggtattaaagtg
ggtgataccgtgtatttccatattacaaatcatgagcaagattttgatgttccgcatggt
tttatgatgataggagccaataattcaggactattgattatgccagggcaaacaaaaact
accgtatgggaaccgaagcaagaaggtgtatggccattttattgtaccgatttctgttct
gctttacatcaagaaatgcaagggtatatacgtgtttcacctgctagttctaatctagat
ctatcttggtctttaggagaataa

DBGET integrated database retrieval system