KEGG   Cellulophaga algicola: Celal_3200Help
Entry
Celal_3200        CDS       T01404                                 

Definition
3-beta hydroxysteroid dehydrogenase/isomerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cao  Cellulophaga algicola
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3673337..3674488)
Genome map
AA seq 383 aa AA seqDB search
MSNEISLITGGNGHLGNNLVRLLLSENKKVRTTVRNIHNQKPFKGLDCEVVQADITDRES
LKKAFQGVTNLYAVAANFSMWAKNPKAEIYDNNMQGTQNVFDIAKECGIKNIVYVSSVAC
LDFTKLPANVDNGYNKDRRNWYYNSKNDSDRLALELGEKYGIRTVLILPSAMIGSKAFKL
SYSNNLVLQVLNGEIPVDTNVTLNWVDVKDVAFGTYKAMLKGRNLERYILSNEKHTTLQE
SVKIASGLYPELKLKKPKKVPKCLLYSIAGLMEFSSKITGKEPLLQRHYLDMFYNLKQDY
DINKSRKELGFNPKSSKKALEDTLKYLKNDWEEKKRYRIEWMASPLNDGVHPSHHPAYGS
RTGRFAIHLSNRSLHQLKLFRTL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaaatttcattaataacaggaggtaacggacatttaggaaacaacttagtt
agattactactttcagaaaataaaaaagtaagaacaacagtcagaaatatacacaatcaa
aaacctttcaaaggattggactgtgaggttgtacaagccgatattactgacagagaatct
ctaaaaaaagcatttcaaggagttacaaacttatatgctgtagctgcaaattttagtatg
tgggctaagaatcctaaagccgaaatttatgacaataatatgcagggaactcaaaatgta
tttgatattgcaaaagaatgtggcataaaaaacattgtatacgtaagctctgtagcctgt
ttagatttcacaaaattacctgctaatgtagataatggatacaataaagacagacgaaat
tggtactacaactctaaaaatgactctgacagattagcattagaactgggagaaaaatat
ggaatcagaactgttctaatccttccatccgcaatgataggttcaaaagcatttaaattg
agttattctaataaccttgtattacaagttttaaatggtgaaataccagtagatacaaat
gtgactttaaattgggtggatgtaaaagatgttgcatttggaacgtataaagcaatgttg
aaaggtagaaatttagaacgttatatcttatcaaacgagaaacacactactctacaagaa
agtgtaaaaatagcatccggtttatatccagaattaaaattaaaaaagccaaagaaagta
cctaaatgcttattgtattctattgcaggactaatggagtttagcagtaaaataacagga
aaagaacctttgctacaaagacactacttagatatgttttataacttaaaacaggattac
gatattaataaatcaagaaaagaattgggttttaatcctaaatcttcaaaaaaagcatta
gaagatactctgaaatatttaaaaaacgattgggaagaaaaaaaacggtatagaatcgag
tggatggcttcgccattaaatgacggagtgcacccctcacaccacccagcgtacgggtct
cgtactgggcggttcgcaatccatctttccaatcgctctttacaccaattgaaactattt
cgtactttatga

DBGET integrated database retrieval system