KEGG   Cellulophaga algicola: Celal_3216Help
Entry
Celal_3216        CDS       T01404                                 

Definition
ATP-cone domain-containing protein
Orthology
K00526  
ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
cao  Cellulophaga algicola
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cao00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cao00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3691023..3692297
Genome map
AA seq 424 aa AA seqDB search
MKITHLIKRDFTTKPFQLNKISNAILKAMTTVNHGDKADADLISKNVHEALLEREETVVN
YTPTVEEVQDFVETKLMEGGFFDVAKAYILYRNEQSQKRKSNIFEKRINLKPYEYPELYE
YVPAIRHSYWIHSEFNFTSDIQDFKTRLTDTEQSAIKNTMLAISQIEVAVKGFWGDIYHK
MPKPEIGSVGATFAESEVRHADAYSHLLEILGLNNEFKNLKKKPAIMKRVQYLETALKNA
KSEDNKDYAESILLFSLFIEHVSLFSQFLIIMAFNKHKNMLKGVSNVVEATSKEEQIHGD
FGIDIIKIIKKENPDWFDADYHKTIQQMCKDAFIAESSVVDWIFEKGELDFLPKDVVNEF
IKNRFNNSLESIGIEKIFEVNEELIAETEWFDDEIIGTKHGDFFVKRSINYSKRTQSITS
DDLF
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacgcatctcatcaagagggattttaccacaaaaccctttcagttaaataag
atctcaaatgccatactaaaagctatgactactgtaaatcatggtgataaggctgatgca
gatttgatttcaaaaaatgttcatgaggcacttttagaacgtgaagaaacggttgttaat
tacacgccaacggttgaagaagtacaagattttgtagaaaccaaactgatggaaggcggt
tttttcgatgttgccaaagcatacattttataccgtaatgagcagtcgcaaaagagaaaa
tcaaatatttttgagaagcgtataaatttaaagccttacgaatatccagagctttatgag
tatgttcctgcgattcgtcattcctattggattcattctgaatttaatttcacgagtgat
attcaagattttaaaacacgccttacagatacagagcaaagcgcgattaaaaacacaatg
ttggctatttctcaaattgaagtagctgttaagggtttttggggagacatttatcataaa
atgccaaaaccagaaataggatctgtaggggctacttttgcagaaagtgaagtacgtcat
gcagatgcgtattcgcaccttcttgaaattctaggcttgaataatgaattcaagaatttg
aagaaaaaaccagcgatcatgaaaagagtgcagtatttagagactgcattaaaaaatgct
aagagtgaggataataaagattatgcagagtctattcttttattttctctctttatagag
catgtttctttattttctcaattcttaattattatggcttttaataagcataagaatatg
ttgaagggggtttcaaatgtagtagaagcaacctctaaagaagagcaaatacacggtgat
tttggtattgatatcattaaaattatcaaaaaagaaaacccagattggtttgatgcagat
taccataagaccatacaacaaatgtgtaaagatgcttttatagcagaaagtagtgttgtg
gactggatttttgaaaagggagagcttgatttcttacctaaggatgtggtgaatgaattt
ataaaaaaccgatttaacaattcgttagaaagtatcggtattgaaaaaatatttgaagta
aacgaagaattaatagcagagacggagtggtttgatgatgaaattattggtaccaaacac
ggcgattttttcgtaaagcgctctattaattatagcaaaagaacacaaagtataactagt
gacgaccttttttag

DBGET integrated database retrieval system