KEGG   Cellulophaga algicola: Celal_3474Help
Entry
Celal_3474        CDS       T01404                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cao  Cellulophaga algicola
Brite
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Celal_3474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3969734..3971512
Genome map
AA seq 592 aa AA seqDB search
MKAKTYTLGICLLLLLTTACKNDKKPLVLVTTDDEITKFYTSHLNNCIQYLEAMKGANQA
EYNIDLYKKARFKFKAIEPILSAIDKNNYKSLNAPNILQVQEEDLTDVKIRNPFGFQVIE
ELLFGAETDSLALYNAIDLTKNRLKLLEKNTQINLKDHHLIWLFRNQIVRTATTGITGFD
SPVLGQSLLESQITYQTLIDLTELLESKFSSNTLYVALIDSFKNSISTLQHDFDSFDRYR
FIQNYTDKQLELLVKVQKDWNVEFPFEMAISNEATSLFDSNTLNIFYFSDYKSDTLRLKE
KQLLGKQLFNDKMLSKNYKMACATCHIKDKAFTDGKKTFDGNQIRNTPSLRYAAYQQTFF
MDGRSGSLEGQIVGVADNHDEFNLPMDSITNRVLKKQPYKIQFDSLYQGKRMEYNVRHAI
ASYIRTLNSFDSKFDKNVNGLEDTLTEEEISGFNLFMGKAVCATCHFAPLFNGTVPPDYK
DTEMELIGVPEQNDTINALISSDLGRYNMFKTAQRKHFFKTPTVRNVEKTSPYMHNGVYT
TLEQVVDFYNRGGGQGIGIEAAYQTLPFDNLALTEKEQASLVAFMKTLTDSE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctaagacatatactttgggtatatgtcttttgcttttactaacaactgcttgt
aagaacgataaaaaaccgcttgttttagtaactacagatgatgaaataactaaattttat
acgtcgcacttaaataattgtattcagtatctagaggctatgaagggtgcaaatcaggca
gaatataatattgatttatataaaaaagcgcgatttaaatttaaagcaattgaacctatc
ttatccgcaattgataagaataattacaagtccctcaatgctcctaacattttgcaagta
caagaagaagatcttacagatgttaagattagaaatccctttgggtttcaggttatagaa
gaattactttttggtgctgagacagacagtttagcactatataatgctatagacttaaca
aaaaaccgacttaaactacttgaaaaaaatacgcaaataaatcttaaagaccatcatcta
atatggctttttaggaatcaaattgtacgtacagccacaacaggtataactggttttgat
tctcccgtattaggacaatctttgttagagagccaaataacctaccaaaccttaattgat
ttaacggagcttttagaatcaaaatttagttccaacaccttgtatgtggcactaatagat
tcattcaaaaattcgatttcaacattacaacatgattttgatagctttgatcggtatcgt
tttattcaaaattatacagacaagcaattagaattattggtgaaagttcaaaaagattgg
aacgttgagtttccttttgaaatggctatttccaatgaagcaacttcgctgtttgattcc
aatacattaaatatattttatttttcagattataaaagtgatacgttacgattgaaagaa
aaacagcttttaggaaagcagttatttaatgataaaatgctatctaaaaattacaaaatg
gcttgcgctacttgtcatataaaagataaagcctttacagatggcaaaaagacatttgat
ggtaatcaaataagaaatacaccaagcttacgctacgccgcataccaacaaacgtttttt
atggatgggcgttccggtagcttagaaggtcaaattgttggagttgctgataatcacgat
gagtttaatttgccaatggattctattacaaatcgtgtactcaaaaaacagccgtataaa
attcagtttgattcactatatcaagggaaaagaatggagtataatgttaggcatgctata
gcttcttacatcagaacgttaaatagttttgactctaaatttgataaaaacgtaaatgga
cttgaagatacattgacggaagaagaaatttctgggtttaatttatttatgggaaaggcg
gtttgtgctacctgtcattttgctcctttatttaatggtaccgtacctcctgattataaa
gataccgaaatggaattgataggtgtacctgaacaaaatgacacgattaatgcgttaata
agtagcgatttagggaggtataatatgtttaagacagcgcaacgaaaacatttttttaag
acgcctacggtaagaaatgttgaaaaaacaagtccttatatgcacaacggagtatataca
acactagaacaagttgttgatttttataatagaggtggagggcaaggaataggaattgaa
gcagcatatcaaacccttccttttgataatttagcactaacagagaaagagcaagcctct
ttggttgcttttatgaaaacactaaccgactcagaataa

DBGET integrated database retrieval system